COPE Advertising options



Previous Next
Search COPE:
 


- C -

Select one of the following:


c

C1ATNF3
C1 domain
C1I
C1INH
C1 inhibitor
C1orf11
C1orf12
C1orf76
C1orf121
C1orf139
C1orf163
C1ORF177
C1orf178
C1orf187
C1orf201
C1q
C1QA
C1q and tumor necrosis factor related protein 1
C1q and tumor necrosis factor related protein 2
C1q and tumor necrosis factor related protein 3
C1q and tumor necrosis factor related protein 4
C1q and tumor necrosis factor related protein 5
C1q and tumor necrosis factor related protein 6
C1q and tumor necrosis factor related protein 7
C1q and tumor necrosis factor related protein 8
C1q and tumor necrosis factor related protein 9
C1q and tumor necrosis factor related protein 9A
C1q and tumor necrosis factor related protein 9B
C1q and tumor necrosis factor related protein 10
C1q and tumor necrosis factor related protein 11
C1q and tumor necrosis factor related protein 12
C1q and tumor necrosis factor related protein 13
C1q and tumor necrosis factor related protein 14
C1q and tumor necrosis factor related protein 15
C1QB
C1QBP
C1QC
C1qdc1
C1qdc2
C1q domain
C1q domain-containing protein 1
C1q domain-containing protein 2
C1q family
C1q globular domain
C1QL1
C1QL2
C1QL3
C1QL4
C1q-like domain
C1q-like protein 1
C1q-like protein 2
C1q-like protein 3
C1q-like protein 4
C1qR1
C1q receptor
C1q receptor for phagocytosis enhancement
C1q-related factor
C1QRF
C1qRp
C1QTNF1
C1QTNF2
C1QTNF3
C1QTNF4
C1QTNF5
C1QTNF6
C1QTNF7
C1QTNF8
C1QTNF9
C1QTNF9A
C1QTNF9B
C1QTNF10
C1QTNF11
C1QTNF12
C1QTNF13
C1QTNF14
C1QTNF15
C1q/TNF-related protein 1
C1q/TNF-related protein 2
C1q/TNF-related protein 3
C1q/TNF-related protein 4
C1q/TNF-related protein 5
C1q/TNF-related protein 6
C1q/TNF-related protein 7
C1q/TNF-related protein 8
C1q/TNF-related protein 9
C1q/TNF-related protein 9A
C1q/TNF-related protein 9B
C1q/TNF-related protein 10
C1q/TNF-related protein 11
C1q/TNF-related protein 12
C1q/TNF-related protein 13
C1q/TNF-related protein 14
C1q/TNF-related protein 15
C1q/TNF-related protein family
C1q/TNF superfamily

C2 domain
C2ORF9
C2orf28
C2orf31
C2ORF40
C2ORF40 mimic peptide fragment
C2ORF40MPF
C2orf89

C3a
C3adesArg
C3adesArg77
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6
C3b
C3bc
C3-beta-c
C3bINA
C3b inactivator accelerator
C3 binding protein
C3bi receptor
C3bR
C3b receptor
C3b/C4b receptor
C3 convertase
C3 convertase activator
C3D-1
C3dR
C3d receptor
C3orf13
C3orf58
C3PA
C3 proaccelerator
C3 proactivator
C3Xkine

C4
C4A
C4a
C4-alpha
C4B
C4b
C4-beta
C4b receptor
C4-gamma
C4L protein
C4orf4
C4orf7
C4orf22
C4orf31
C4orf52
C4 protein

C5
C5a anaphylatoxin
C5a anaphylatoxin chemotactic receptor
C5a anaphylatoxin chemotactic receptor C5L2
C5a anaphylatoxin receptor
C5adesArg
C5aR
C5AR1
C5a receptor
C5AR2
C5a receptor-like 2
C5b-9
C5 convertase
C5FW
C5L2
C5ORF23
C5R1

C6
C6(30-48)
C6-beta-Chemokines
C6L protein
C6orf8
C6orf73
C6orf76
C6orf144
C6ORF150
C6orf187
C6 protein

C7
C7orf9

C8FW
C8orf57

C9orf2
C9orf8
C9orf10
C9orf13
C9orf26
C9orf82
C9orf83
C9orf89
C9orf90
C9orf94
C9orf121
C9orf155
C9orf164
C9orf165
C9-related protein

C10
C10orf13
C10orf49
C10orf54
C10orf59
C10orf72
C10orf83
C10ORF97
C10orf99
C11orf32
C11orf43
C11orf82
C11R
C12L
C12orf5
C12ORF39
C12orf48
C12 Peptide
C13
C13orf15
C13orf24
C14ORF4
C14ORF27
C14orf96
C14orf108
C14orf141
C14orf153
C14TKL-1
C15orf1
C16-LacCer
C16-Lactosylceramide
C16 laminin peptide
C16L protein
C16orf5
C16orf23
C16orf77
C16 peptide
C16 protein
C16S peptide
C16Y peptide
C17
C1.7
C17orf33
C17orf60
C17orf88
C17orf99
C18G
C18X
C19
C19orf10
C19orf13
C19orf33
C19orf63
C19orf75
C19orf80

C20orf8
C20orf63
C20orf70
C20orf71
C20orf82
C20orf97
C20orf102
C20orf103
C20orf114
C20orf122
C20orf149
C20orf153
C20orf158
C20orf182
C20orf183
C20orf184
C20orf185
C20orf186
C21L
C21orf1
C21orf3
C21orf11
C22-LacCer
C22-Lactosylceramide
C22L protein
C22orf3
C23
C23L
C23 peptide
C24-LacCer
C24-Lactosylceramide
C27

C33
C-36 peptide

C48
C49a

C56

C9.1
c98

C105Y peptide
C-193

C219-reactive peptide

C328-15

C8/144B antigen

ca
CA
Ca(2+)-binding CUB domain
CA11
CA2_1
CA 15.3
CAAF-1
CAAF-2
CaAMP1
CAAP
CAAP1
CAAP47
CAAP48
Ca2+-binding protein from mouse Ehrlich ascites tumour cells
Cab45
Cab45b
Cab45-C
Cab45-G
Cab45-S
Cabin-A1
Cabin-A2
c-abl
CaBP
CaBP4
CaBP9K
CaBP33
CaBP37
Cabut
CAC-1
CAC-2
CAC-3
CAC-4
CAC-5
CAC-6
CAC-7
CAC-8
CAC-9
CAC-10
CAC-11
CAC-12
CAC-13
CAC-14
CAC-15
CAC-16
CAC-17
CAC-18
Cacfd1
Cachectin
Cachexia inducing factor
CACP
CACs
cact
cactus
CACY
CAD
CAD6
CAD27 peptide
CADASIL
CADD
Cadherin-1
Cadherin-2
cadherin-5
cadherin-6
Cadherin-6B
cadherin-13
Cadherin family member 5
Cadherin family member 12
cadherin-related family member 16
CADM-140 autoantigen
Caenacin-2
Caenacins
Caenopore-5
Caenopores
Caenorhabditis elegans
Caenorhabditis elegans BNIP3 homolog
Caerin 1.1
Caerin 1.4
Caerin 1.6
Caerin 1.7
Caerin 1.8
Caerin 1.9
Caerin 1.10
Caerin 1.17
Caerin 1.18
Caerin 1.19
Caerin 3.5
caerins
Caerulein
caerulein-precursor fragment 1
caerulein-precursor fragment 3
caerulein-precursor fragment 4
caerulein-precursor fragment 5
caerulein-precursor fragment 6
caerulein-precursor fragment 7
caerulein-precursor fragment AM1
caerulein-precursor fragment B1
caerulein-precursor fragment C1
caerulein-precursor fragment P1
caerulein-precursor fragment P2
caerulein-precursor fragment P3
caerulein precursor fragment peptides
caerulein-precursor fragment SE1
caerulein-precursor fragment SE2
caerulein-precursor fragment SE3
caerulein-precursor fragment ST3
caerulein precursor-related fragment Ea
caerulein precursor-related fragment Eb
caerulein precursor-related fragment Ec
caerulein precursor-related fragments
caeruloplasmin
CAF
CAFCs
CAFF
CAG-2
cag26
CagA
CAGA
CAGB
CAG pathogenicity island protein 26
CAG trinucleotide repeat sequence 2
CAIR-1
CAI stressed-1
Cajal body-associated RNAs
Cajal cells
Cajal interstitial cells
Cajal-like cells
Cajal-Retzius cells
cak
CAL
CAL1L
CALB3
calbindin 3
calbindin-D9K
CALC1
CALC2
CALCA
CALCB
CALC-I
Calciferin
Calcitermin
Calcitonin
calcitonin 1
calcitonin cells
calcitonin D
Calcitonin gene-related peptide
Calcitonin gene-related peptide-1
Calcitonin gene-related peptide-2
Calcitonin gene-related peptide neurons
calcitonin gene-related peptide-receptor component protein
Calcitonin gene-related polypeptide-alpha
Calcitonin gene-related polypeptide-beta
calcitonin-like diuretic hormone
calcitonin-like diuretic hormone 31
calcitonin-like diuretic hormone/diuretic hormone 31
calcitonin M
calcitonin receptor
calcitonin receptor 1
calcitonin receptor-like receptor
Calcitonin-receptor-like receptor activity-modifying protein 1
Calcitonin-receptor-like receptor activity-modifying protein 2
Calcitonin-receptor-like receptor activity-modifying protein 3
calcitonin-related polypeptide-alpha
calcium binding protein 4
calcium binding protein 15
calcium binding protein 33 kDa
calcium binding protein 37 kDa
calcium-binding protein 45 kDa
Calcium-binding protein in amniotic fluid-1
Calcium-binding protein in amniotic fluid-2
calcium channel flower domain containing 1
calcium channel flower homolog
Calcium-dependent guanylate cyclase activator protein
Calcium ionophore
calcium-mediated cell death
Calcium oxalate crystal growth inhibitor protein
calcium placental protein
calcium pyrophosphate deposition disease
CALCR
CALCRL
calcyclin
calcyclin-like protein
CALEB
Calfi-PVK
Calgizzarin
Calgranulin A
Calgranulin B
Calgranulin C
Calgranulin C(78-92)
Calgranulin-related protein
Calgranulins
caliciform cells
califin A
califin B
califin C
califins
CALLA
CALLA(+) cells
Callatostatin-1
Callatostatin-2
Callatostatin-3
Callatostatin-4
Callatostatin-5
callatostatins
CALL FOR CONTRIBUTIONS
calliFMRFamides
callinectin
Calliphora vomitoria myosuppressin
Calliphorin
callisulfakinin I
callisulfakinin II
callisulfakinins
callitachykinin 1
callitachykinin 2
callitachykinins
calm-down signals
CALML3
calmodulin-like 3
calmodulin-like protein
Calmodulin-related protein NB-1
Calmodulins
CALNUC
Calpactin-1
Calpactin-1 light chain
calpactin-2
Calpactin p11
Calpain 6
Calphobindin
Calphobindin-1
Calphostin C
calponin homology domain
Calpromotin
Calprotectin
CALR
calregulin
Calreticulin
calreticulin(1-180)
calreticulin(133-180)
calreticulin(135-164)
Calreticulin transacylase
Calsenilin
Calstabin 1
caltrin
Calvasculin
calycocytes
Calyculin A
CAM 120/80
CA macrophages
CAM assay
Cambridge pathology 1 antigen
CaMCA1
cameloid cells
CAMK-like CREB regulatory kinase 1
CAML1
CA-MMP
CAMP
CAMP(132-170)
CAMP(134-170)
CAMP211-225
CAMPATH-1
CAMPATH-1G
CAMPATH-1H
CAMPATH-1M
cAMP-dependent protein kinase-anchor protein 250
cAMP-dependent protein kinase catalytic subunit PRKX
cAMP-dependent transcription factor-7
caMPhi
cAMP responsive element
cAMP-responsive element-binding protein 3-like protein 2
cAMP responsive element binding proteins
cAMP responsive element binding protein-1
cAMP responsive element binding protein-2
camptodactyly-arthropathy-coxa vara-pericarditis
Campylobacter Cytolethal distending toxin
CAM-RF
Canale-Smith syndrome
canalicular bile acid transport protein
Canal neuromasts
c-ANCA
cancer- and metastasis-initiating cells
cancer antigen 15.3
cancer-associated fibroblasts
cancer-associated microRNAs
cancer-associated osteoblast-like cells
Cancer-associated SCM-recognition, immunedefense suppression, and serine protease protection peptide
Cancer cachectic factor
cancer cell organoids
cancer immunoediting
cancer immunosubversion
cancer immunosurveillance
cancer initiating cells
cancer metastasis-initiating cells
cancer organoids
cancer-placenta antigen 1
cancer propagating cells
cancer recognition, immune defense suppression, and serine protease protection peptide
cancer-related gene liver 2
cancer repopulating cells
cancer spheres
cancer spheroids
cancer stem cells
cancer stem-like cells
cancer stemloids
cancer-targeting peptides
Cancer/testis antigen 15
Cancer/testis antigen 16
Cancer/testis antigen 31
Cancer/testis antigen 34
Cancer/testis antigen 58
cancer/testis antigen 71
cancer/testis antigen 72
Cancer/testis antigen 73
cancer/testis antigen 100
cancer/testis antigen 102
Cancer/testis antigen 16.1
Cancer/testis antigen 80.1
Cancer vaccination
Cancrin
candelabrum cells
candelabrum neurons
CANDF2
CANDF4
Candida albicans metacaspase-1
Candidalysin
Candidate Plasticity Gene 15
candidiasis familial 2
candidiasis familial 4
Canine distemper virus V protein
Canofin 1
Canofin 2
Canofin 3
Canofins
canonical FGF family
canonical inflammasome
canonical miRNAs
canonical NF-kappa-B pathway
canonical Notch ligands
canonical reprogramming factors
canonical Wnt/beta-catenin pathway
canonical Wnt cascade
canonical Wnt proteins
canonical Wnt signaling
canopy-2 homolog
canopy cells
canopy homolog 2
Canstatin
Canstatin-C
Canstatin-N
CAP
CAP-1
CAP1
CAP1a
CAP1b
CAP2
CAP-2
CAP2a
CAP2b
CAP2b-1
CAP2b-2
CAP2c
CAP3
CAP4
CAP5
CAP6
CAP11
CAP-18
CAP-23
CAP-37
CAP57
CAP37(20-44)
CAP37(120-146) QH
CAP37(120-146) QR
capa
Capa-1
Capa-2
Capa-3
capability
CAPA-periviscerokinins
Capa-pyrokinins
capaR
capa receptor
CAP-Gly domain-containing linker protein 1
CAP-IF
capillary sprouting
Capillary tube formation assay
Capistruin
CAPL
CAPN6
CAPRIN2
CAPS1
CAPS2
CAPS3
Capsicum annuum antimicrobial peptide 1
CAR
Carassin
carbohydrate antigen 15.3
carbohydrate binding modules
carbohydrate binding protein-35
carbohydrate recognition domains
carboxyl ester lipase
carboxylic ester hydrolase
carboxylmethylsulfate dextran-benzylamide
carboxylmethylsulfate dextran
carboxyl-terminal adjacent peptide
carboxypeptidase E
carboxypeptidase H
carboxyterminal-pro-AVP
Carboxy terminus of Hsp70-interacting protein
CAR cells
Carcinin
carcinoembryonic antigen
carcinoembryonic antigen 2
carcinoembryonic antigen 3
carcinoembryonic antigen 11
Carcinoembryonic antigen-related cell adhesion molecule 1
Carcinoembryonic antigen-related cell adhesion molecule 2
Carcinoembryonic antigen-related cell adhesion molecule 3
Carcinoembryonic antigen-related cell adhesion molecule 5
Carcinoembryonic antigen-related cell adhesion molecule 6
Carcinoembryonic antigen-related cell adhesion molecule 8
carcinoma-associated fibroblasts
carcinoma-associated mucin
carcinoma-derived growth factor
carcinospheres
CARD2
CARD3
CARD4
CARD5
CARD6
CARD7
CARD8
CARD9
CARD10
CARD11
CARD12
CARD14
CARD15
CARD16
CARD17
CARD18
CARD19
CARD adapter inducing interferon-beta
CARD containing IL1-beta converting enzyme-associated kinase
CARD-containing inhibitor of NOD1 and CARD-containing ICE-associated kinase-induced NF-kappa-B activation protein
CARD containing molecule enhancing NF-kB mRNA
CARD domain
cardiac adriamycin-responsive protein
Cardiac ankyrin repeat protein
cardiac atriocytes
cardiac conduction cells
cardiac C-reactive protein
cardiac CRP
cardiac histiocytes
cardiac interstitial cells
cardiac microvascular endothelial cells
cardiac muscle actin-alpha-1
cardiac muscle cells
cardiac myocytes
cardiac pacemaker cells
cardiac Purkinje cells
cardiac targeting peptide
cardiac tissue macrophages
cardiac ventriculocytes
CARDIAK
CARDIF
CARDINAL
CARD-inhibitor of NF-kappa-B-activating ligands
CARD LRR and NACHT domain-containing protein
CARD LRR and NACHT domain-containing protein A
CARD LRR and NACHT domain-containing protein B
CARD LRR and NACHT domain-containing protein C
CARD LRR and NACHT domain-containing protein D
Cardioacceleratory Peptide 1
Cardioacceleratory Peptide 1a
Cardioacceleratory Peptide 1b
Cardioacceleratory Peptide 2
Cardioacceleratory Peptide 2a
Cardioacceleratory Peptide 2b
Cardioacceleratory Peptide 2c
Cardioacceleratory peptides
cardioactive peptide
cardiocytes
cardiodilatin
cardiokines
cardiomyoblasts
cardiomyocytes
cardiomyokines
Cardionatrin
Cardionatrin I
Cardionatrin IV
cardiospheres
Cardiotrophin-1
cardiotrophin-2
cardiotrophin-like cytokine
cardiotrophin-like cytokine factor-1
CARD-like apoptotic protein
CARD-MAGUK protein-1
CARD-MAGUK protein-2
CARD-MAGUK protein-3
CARD only protein
CARD only protein-1
CArG box
CAR/LepR(+) cells
CARLNCVPKGTSGNTETCPCYASLHSCRKYG
CARMA1
CARMA2
CARMA3
CARMEN
Carminerin
Caronte
carotid artery smooth muscle cells
carotid body cells
carotid body chemoreceptor cells
Carotid chemoreceptors
carotid body chief cells
carotid body chromaffin cells
carotid body epithelioid cells
carotid body glomus cells
carotid body pericytes
carotid body sheath cells
carotid body sustentacular cells
carotid body type 1 cells
carotid body type 1 glomus cells
carotid body type 2 cells
carotid body type 2 glomus cells
carotid chemoreceptor cells
CARP
CARP-1
Carpal tunnel syndrome 1
CARPAR
carpet cells
carpet glial cells
CARs
CARSKNKDC
CART
CART-1
CART(1-39)
CART(1-89)
CART(10-89)
CART(37-54)
CART(37-55)
CART(42-89)
CART(49-89)
CART(60-79)
CART(55-102)
CART(62-102)
CAR T-cells
CART neurons
CART prepropeptide
CARTPT
Cartducin
cartilage acidic protein 1
cartilage acidic protein 1A
cartilage acidic protein 1B
cartilage cells
Cartilage-derived anti-tumor factor
Cartilage-derived factor
Cartilage-derived growth factor
Cartilage-derived growth factor-1
Cartilage-derived growth factor-1.7
Cartilage-derived inhibitor
Cartilage-derived morphogenetic protein
Cartilage-derived morphogenetic protein-1
Cartilage-derived morphogenetic protein-2
Cartilage-derived morphogenetic protein-3
cartilage-derived retinoic acid-sensitive protein
cartilage-forming cells
cartilage glycoprotein 39
Cartilage Hair Hypoplasia
Cartilage inducing factor A
Cartilage inducing factor B
cartilage intermediate layer protein
cartilage intermediate layer protein 1
cartilage intermediate layer protein-2
Cartilostatin-1
Cartilostatin-2
cartonectin
CART prepropeptide(76-96)
CARTPT(76-96)
Cartwheel cells
Cartwheel neurons
Cartwright antigen
Cartwright blood group
CAS
Cas1
Cas2
Cas3
Cas4
Cas5
Cas6
Cas7
Cas8
Cas9
Cas9b
Cas9S
Cas10
Cas10a
Cas10b
Cas10c
Cas10d
Cas11
Cas12
Cas13
Cas14
casA
casa
CASA
casB
CASB
caseating necrosis
casecidins
casecidin 15
casecidin 17
caseicin A
caseicin B
caseicin C
caseicins
casein
Casein 24
Casein 89
Casein201
casein-alpha
casein-alpha(90-95)
casein-alpha(90-96)
casein-alpha-s1
casein-alpha-s1(1-9)
casein-alpha-s1(1-23)
casein-alpha-s1(16-23)
casein-alpha-s1(21-29)
casein-alpha-s1(23-34)
casein-alpha-s1(24-47)
casein-alpha-s1(30-37)
casein-alpha-s1(35-42)
casein-alpha-s1(90-95)
casein-alpha-s1(90-96)
casein-alpha-s1(99-105)
casein-alpha-s1(99-109)
casein-alpha-s1(102-109)
casein-alpha-s1(104-109)
casein-alpha-s1(114-124)
casein-alpha-s1(142-147)
casein-alpha-s1(157-164)
casein-alpha-s1(158-162)
casein-alpha-s1(158-164)
casein-alpha-s1(169-193)
casein-alpha-s1(174-184)
casein-alpha-s1(194-199)
casein-alpha-s1(195-208)
casein-alpha-s2
casein-alpha-s2(1-32)
casein-alpha-s2(25-41)
casein-alpha-s2(40-47)
casein-alpha-s2(150-188)
casein-alpha-s2(164-179)
casein-alpha-s2(165-203)
casein-alpha-s2(174-179)
casein-alpha-s2(174-181)
casein-alpha-s2(182-189)
casein-alpha-s2(183-206)
casein-alpha-s2(183-207)
casein-alpha-s2(189-192)
casein-alpha-s2(190-197)
casein-alpha-s2(198-202)
Casein-alpha-s2-like A
casein-beta
casein-beta(1-28)
casein-beta(24-38)
casein-beta(25-29)
casein-beta(26-30)
casein-beta(41-44)
casein-beta(54-59)
casein-beta(58-63)
casein-beta(58-76)
casein-beta(59-64)
casein-beta(60-63)
casein-beta(60-64)
casein-beta(60-65)
casein-beta(60-66)
casein-beta(60-68)
casein-beta(60-69)
casein-beta(60-70)
casein-beta(63-68)
casein-beta(74-76)
casein-beta(80-89)
casein-beta(80-90)
casein-beta(84-86)
casein-beta(94-123)
casein-beta(108-113)
casein-beta(114-118)
casein-beta(114-119)
casein-beta(121-128)
casein-beta(134-138)
casein-beta(140-143)
casein-beta(169-174)
casein-beta(169-175)
casein-beta(170-176)
casein-beta(177-183)
casein-beta(178-182)
casein-beta(184-210)
casein-beta(191-193)
casein-beta(192-198)
casein-beta(193-198)
casein-beta(193-202)
casein-beta(193-207)
casein-beta(193-209)
casein-beta(197-213)
casein-beta(199-204)
casein-beta(201-220)
casein-beta(213-226)
Casein-beta A1
Casein-beta A2
Casein-beta B
casein-derived iron-chelating peptides
casein-gamma
casein-gamma(108-113)
casein-gamma(114-121)
casein-kappa
casein-kappa(17-21)
casein-kappa(18-24)
casein-kappa(25-34)
casein-kappa(30-32)
casein-kappa(31-34)
casein-kappa(35-41)
casein-kappa(42-49)
casein-kappa(43-97)
casein-kappa(58-61)
casein-kappa(61-44)
casein-kappa(64-75)
casein-kappa(57-134)
Casein-kappa(89-109)
casein-kappa(103-111)
casein-kappa(106-112)
casein-kappa(106-116)
casein-kappa(106-124)
casein-kappa(108-110)
casein-kappa(106-169)
casein-kappa(112-116)
casein-kappa(113-116)
casein-kappa(118-121)
casein-kappa(139-146)
casein-kappa(141-146)
casein-kappa(158-164)
casein-kappa(162-169)
casein-kappa(163-171)
casein-kappa(165-171)
casein-kappa(185-190)
casein kinase 2-beta binding protein 1
casein macropeptide
Caseinoglycomacropeptide
Caseinoglycopeptide
Caseinolytic peptidase B
Caseinomacropeptide
Caseinophosphopeptides
casein phosphopeptides
Caseins
caseous necrosis
CASH
CASK
CASMC
Casocidin-1
casokinins
casomorphins
Casoparan
Casoplatelin
casoxin 4
casoxin 6
casoxin A
casoxin B
casoxin C
Casoxin D
casoxins
CASP1
CASP2
CASP3
CASP4
CASP5
CASP6
CASP7
CASP8
CASP8AP2
CASP8IP1
CASP8p41
CASP9
CASP9b
CASP9S
CASP10
CASP10a
CASP10b
CASP10c
CASP10d
CASP11
CASP12
CASP13
CASP14
CASP15
CASP16P
caspa
Caspar
Caspase-1
Caspase-1-alpha
Caspase-1-zeta
Caspase-1 inhibitor
Caspase-2
Caspase-2L
Caspase-2L-Pro
Caspase-2S
Caspase-2s-Pro
Caspase-3
Caspase-4
Caspase-5
Caspase-6
Caspase-7
caspase-7-like protein
Caspase-8
Caspase-8a
Caspase-8 and FADD-like apoptosis regulator
Caspase-8-associated protein 2
Caspase-8b
Caspase-8c
Caspase-8d
Caspase-8e
Caspase-8f
Caspase-8g
Caspase-8h
Caspase-8 interacting protein 1
Caspase-8L
caspase-8 p41
Caspase-8 related protein
caspase-8s
Caspase-9
Caspase-9-alpha
Caspase-9b
Caspase-9-beta
Caspase-9-gamma
Caspase-9S
Caspase-10
Caspase-10a
Caspase-10b
Caspase-10c
Caspase-10d
Caspase-11
Caspase-12
Caspase-13
Caspase-14
Caspase-14a
Caspase-14b
Caspase-15
Caspase-16
Caspase-17
Caspase-18
caspase a
caspase activation and recruitment domain
caspase-activated DNAse
Caspase-activated DNase inhibitor that interacts with ASK1
Caspase activated nuclease
caspase activity and apoptosis inhibitor 1
Caspase and RIP adaptor with death domain
caspase b
Caspase eight-related protein
caspase homolog
caspase-independent cell death
caspase-independent mitotic death
caspase inhibitor p35
caspase-like apoptosis-regulatory protein
caspase recruitment domain
caspase recruitment domain containing pro-apoptotic protein
caspase recruitment domain-containing protein-2
caspase recruitment domain-containing protein-3
caspase recruitment domain-containing protein-4
caspase recruitment domain-containing protein-5
caspase recruitment domain-containing protein-6
caspase recruitment domain-containing protein-7
caspase recruitment domain-containing protein-8
caspase recruitment domain-containing protein-9
caspase recruitment domain-containing protein-10
caspase recruitment domain-containing protein-11
caspase recruitment domain-containing protein-12
caspase recruitment domain-containing protein-14
caspase recruitment domain-containing protein-15
caspase recruitment domain-containing protein-16
caspase recruitment domain-containing protein-17
caspase recruitment domain-containing protein-18
caspase recruitment domain-containing protein-19
caspase recruitment domain-containing protein-27
Caspases
Caspases-8 and-10-associated RING finger protein 1
caspb
Casper
Casper-S
Caspin
CASPR
CASPR1
CASPR4
Caspy
Caspy2
castration cells
Castration-induced prostatic apoptosis-related protein 1
CAT
Catabolin
CataCopia
Catalase
catch-relaxing peptide
CAT development factor
catecholamine regulated 40 kDa protein
catecholaminergic amacrine cells
catecholaminergic neurons
catecholamine-storing cells
caterpillar cells
CATERPILLER
CATERPILLER family
catesbeianalectin
Catesbeianin-1
Cateslytin
Catestatin
Cat eye syndrome critical region protein 1
CATF
CATH-B1
Cathelicidin
cathelicidin 1
cathelicidin 2
cathelicidin 3
cathelicidin 4
cathelicidin 5
cathelicidin 6
cathelicidin 7
cathelicidin-18
Cathelicidin-AL
cathelicidin antimicrobial peptide
cathelicidin B1
Cathelicidin-BF
cathelicidin-PY
Cathelicidins
cathelin
cathelin antimicrobial peptide
cathelin B9
cathelin domain
cathelin-like domain
Cathelin-related antimicrobial peptide
Cathelin-related peptide SC5
cathepsin G-like-1
cathepsin G-like-2
cathepsin L
cathepsin L1
Cathepsin S
CATHL1
CATHL2
CATHL3
CATHL4
CATHL5
CATHL6
CATHL7
cationic antibacterial polypeptide of 11 kDa
cationic antimicrobial peptides
Cationic antimicrobial protein-37
cationic antimicrobial protein 57
cationic antimicrobial protein of 18 kDa
cationic HDGF
cationic hypothalamus-derived growth factor
Cation-independent mannose 6-phosphate receptor
cation transport regulator homolog 1
cation transport regulator-like 1
CATL
CatS
CAV
CAV1
caveolae associated protein 2
caveolae protein 1
caveolae protein 22 kDa
caveolated cells
Caveolin
Caveolin-1
Caveolin-1 Scaffolding Domain Peptide
Caveolin-1 Scaffolding Domain Peptide-1
Caveolin-1 Scaffolding Domain Peptide-7
caveolin1(82-101)
cavicapture
cavin-2
CAYHRLRRC

CB9
CBA
CBATP
CBC cells
cbCUB domain
CBD103
CBEGF
CBFGF
CBGF
CB glomus cells
cbl
Cbl-interacting protein 85 kDa
CBLN1
CBLN2
CBLN3
CBLN4
Cblnl1
CBM
CBM complex
CBM signalosome
CBO-P11
CBO-P23M
CBP
CBP-1
CBP-2
CBP2
CBP-15
CBP-35
CBP-I
CBPs
Cbt
CBV3 2B protein

CC
cC1qR
CC10
CC16
CCAAT enhancer binding protein-beta
CCAAT/enhancer binding protein zeta
cCAF
CCAL1
C-CAM
C-CAM1
C-CAM1a
C-CAM1b
C-CAM2
C-CAM2a
C-CAM2b
C-CAM/gp110
CCAP
CCAR1
c-CARMEN
CCBE1
c-cbl
CCBP2
CCB peptide
CCCA
CC-Chemokine-activated killer
CC chemokine ligand 1
CC chemokine ligand 2
CC chemokine ligand 3
CC chemokine ligand 4
CC chemokine ligand 5
CC chemokine ligand 6
CC chemokine ligand 7
CC chemokine ligand 8
CC chemokine ligand 9
CC chemokine ligand 10
CC chemokine ligand 11
CC chemokine ligand 12
CC chemokine ligand 13
CC chemokine ligand 14
CC chemokine ligand 15
CC chemokine ligand 16
CC chemokine ligand 17
CC chemokine ligand 18
CC chemokine ligand 19
CC chemokine ligand 20
CC chemokine ligand 21
CC chemokine ligand 22
CC chemokine ligand 23
CC chemokine ligand 24
CC chemokine ligand 25
CC chemokine ligand 26
CC chemokine ligand 27
CC chemokine ligand 28
CC-Chemokine receptor 1
CC-Chemokine receptor 2
CC-Chemokine receptor 2A
CC-Chemokine receptor 2B
CC-Chemokine receptor 3
CC-Chemokine receptor 4
CC-Chemokine receptor 5
CC-Chemokine receptor 6
CC-Chemokine receptor 7
CC-Chemokine receptor 8
CC-Chemokine receptor 9
CC-Chemokine receptor 9B
CC-Chemokine receptor 10
CC-Chemokine receptor 10A
CC-Chemokine receptor 10B
CC-Chemokine receptor 11
CC-Chemokine receptor 13
CC-Chemokines
CC chemokine with stalk CK2
CC-CKR1
CC-CKR2
CC-CKR2A
CC-CKR2B
CC-CKR3
CC-CKR4
CC-CKR5
CC-CKR10
CCD41
CCDC3
CCDC23
CCDC80
CCDC132
CCDC134
CC domain
C-cells
C cells
CCF
CCF-1
CCF18
CCg
CCG2
CCG-B7
CCHa1-R
CCHa2-R
CCHamide-1
CCHamide-1 receptor
CCHamide-2
CCHamide-2 receptor
C-Chemokines
CCICs
C-C-Intercrines
CCK
CCK1
CCK-1 receptor
CCK-2 receptor
CCK-4
CCK-5
CCK-7
CCK-8
CCK-8NS
CCK-8S
CCK-9
CCK-10
CCK-12
CCK-18
CCK-22
CCK-25
CCK-33
CCK-39
CCK-58
CCK(21-40)
CCK(21-44)
CCK(71-103)
CCKAR
CCK-A receptor
CCK-B
CCKBR
CCK-B receptor
CCK cells
CCK-C receptor
CCKergic neurons
CCK-like receptor at 17D1
CCKLR-17D1
CCK neurons
CCK octapeptide
CCK-OP
CCK-PZ
CCK releasing peptide
CCK-RP
CCK splice variant
CCKsv
CCL1
CCL2
CCL3
CCL3L1
CCL3-like-1
CCL3L2
CCL3-like-2
CCL3L3
CCL3-like-3
CCL4
CCL4L1
CCL4-like-1
CCL4L2
CCL4-like-2
CCL5
CCL6
CCL7
CCL8
CCL9
CCL10
CCL11
CCL12
CCL13
CCL14
CCL14a
CCL14b
CCL15
CCL16
CCL17
CCL18
CCL19
CCL20
CCL21
CCL21a
CCL21-alpha
CCL21b
CCL21-beta
CCL21c
CCL21-Leu
CCL21-Ser
CCL22
CCL23
CCL24
CCL25
CCL26
CCL27
CCL28
CCL28-C
CCL-39
CCL-64
CCL-185
CCL1(1-70)
CCL1(1-73)
CCL14[1-74]
CCL14[9-74]
CCL15(1-92)
CCL2(51-62)
CCL2(65-76)
CCL13(19-37)
CCL13(57-75)
CCL15(25-92)
CCL20(51-70)
CCL20(59-70)
CCL28(77-105)
CCLi1
CCLi2
CCLi3
CCLi4
CCLi7
CCM3
C-C motif, ligand 1 inflammatory
C-C motif, ligand 2 inflammatory
C-C motif, ligand 3 inflammatory
C-C motif, ligand 4 inflammatory
CCN1
CCN2
CCN3
CCN4
CCN5
CCN6
CCN1(234-251)
CCN family
CCND2(139-144)
CCP
CCP1
CCP2
CCP3
CCP4
CCP5
CCP22
CCP module-containing protein 22
CCR1
CCR2
CCR2A
CCR2B
CCR3
CCR4
CCR5
CCR6
CCR7
CCR8
CCR9
CCR9B
CCR10
CCR10A
CCR10B
CCR10-related receptor
CCR10rR
CCR11
CCR13
CCR5-2
CCRG
CCRL1
CCRL2
CCRL2A
CCRL2B
cCRP
CCS-3
CCSCs
CCSF
CC-SIG
CCSMC
CCSP
CCSP-1
CCSP-2
CCX-CKR
CCX-CKR2
CCXCR1

Cd
CD1
CD1a
CD1b
CD1c
CD1d
CD1d1
CD1d2
CD1d restricted T-cells
CD1e
CD2
CD2 binding protein 2
CD2BP2
CD2 cytoplasmic domain-binding protein 2
CD2 tail-binding protein 2
CD2F-10
CD2 family
CD2 family member 10
CD2-like receptor activating cytotoxic cells
CD2R
CD2 subset 1
CD3
CD3d
CD3D-1
CD3-delta
CD3e
CD3-epsilon
CD3-eta
CD3g
CD3-gamma
CD3H
CD3Q
CD3z
CD3-zeta
CD4
CD4(+) CD8(+) macrophages
CD4 cells
CD4(+) cells
CD4(+) CD25(+) suppressor T-cells
CD4M33
CD5
CD5L
CD5-like
CD6
CD6L
CD6L-100
CD6 ligand
CD7
CD8
CD8a
CD8-alpha
CD8b
CD8b1
CD8-beta
CD8 cells
CD8(-) cDCs
CD8(+) cDCs
CD8(+) cells
CD8(-) conventional dendritic cells
CD8(+) conventional dendritic cells
CD8 positive cell antiviral factor
CD9
CD9P
CD9P-1
CD9P-1(724-832)
CD9 partner
CD9 partner 1
CD10
CD1.1
CD11
CD11a
CD11b
CD11b/CD18
CD11b(+)Gr-1(dim) tolerogenic DC-like cells
CD11b(+)Gr-1(dim) tolerogenic dendritic cell-like cells
CD11b/c upregulating and chemotactic factor
CD11b(+) Gr-1(+) myeloid cells
CD11b(high) Ia(low) DCs
CD11b(high) Ia(low) dendritic cells
CD11c
CD11c(+) B-cells
CD11c-like B-cells
CD11d
CD1.2
CD12
CD13
CD14
CD14(++) CD16(-) monocytes
CD14(++) CD16(+) monocytes
CD14(+) CD16(++) monocytes
CD14(+) CD16(high) monocytes
CD14(high) CD16(+) monocytes
CD14(high) CD16(-) monocytes
CD15
CD15s
CD15u
CD16
CD16a
CD16b
CD17
CD18
CD18/CD11a
CD18/CD11b
CD18/CD11c
CD19
CD19(+) CD25(+) B-cells
CD19(+) CD25(high) B-cells
CD19(+) CD38(high) CD24(high)
CD19(+) lymphocytes
CD20
CD20L
CD20L1
CD20L5
CD20-like
CD20-like-1
CD20-like-5
CD21
CD21L
CD21S
CD22
CD22a
CD22-alpha
CD22b
CD22-beta
CD22c
CD23
CD23a
CD23b
CD24
CD24a
CD24b
CD24c
CD25
CD25 expression inhibitory protein
CD26
CD27
CD27 binding protein
CD27BP
CD27(-) IgD(-) B-cells
CD27L
CD27LG
CD27 ligand
CD28
CD28H
CD28 homolog
CD28L
CD28LG1
CD28LG2
CD28 ligand
CD28 ligand-1
CD28 ligand-2
CD28-related protein-1
CD29
CD30
CD30L
CD30 ligand
CD30v
CD31
CD32
CD32a
CD32b
CD32b1
CD32b2
CD32c
CD33
CD33 antigen-like
CD33 antigen-like-1
CD33 antigen-like-2
CD33 antigen-like-3
CD33L
CD33L1
CD33L2
CD33L3
CD33-like-1
CD33-like-2
CD33-like-3
CD33-like SIGLECs
CD33m
CD33M
CD34
CD34(+) dendritic cells
CD34(+) dendritic interstitial cells
CD34(+) fibroblasts
CD34(+) fibrocytes
CD34(+) keratocytes
CD34(+) reticular network cells
CD34(+) SFCs
CD34(+) spindle cells
CD34(+) spindle-shaped cells
CD34(+) stromal cells
CD34(+) stromal fibroblastic/fibrocytic cells
CD34(+) undifferentiated smooth-muscle cells
CD35
CD36
CD37
CD38
CD39
CD39(high) B-cells
CD39L1
CD39L2
CD39L3
CD39L4
CD39-like-1
CD39-like-2
CD39-like-3
CD39-like-4
CD40
CD40-associated protein 1
CD40-binding protein
CD40BP
CD40L
CD40LG
CD40 ligand
CD40L receptor
CD40LT
CD40 receptor associated factor-1
CD40 receptor associated protein p23
CD41
CD41a
CD41b
CD42a
CD42b
CD42b-alpha
CD42b-beta
CD42c
CD42d
CD43
CD44
CD44A
CD44c
CD44(-) CD62L(+) T-cells
CD44(+) CD62L(-) T-cells
CD44(+) CD62L(+) T-cells
CD44E
CD44H
CD44(high) CD127(high) KLRG1(low) cells
CD44(high) CD127(low) KLRG1(high) cells
CD44HSPG
CD44(+) KLRG1(+) CD122(+) T-cells
CD44M
CD44R
CD44R1
CD44R2
CD44RC
CD44s
CD44st
CD44std
CD44v
CD44v1
CD44v2
CD44v3
CD44v4
CD44v5
CD44v6
CD44v7
CD44v8
CD44v9
CD44v10
CD44v11
CD44v4/5
CD44v7/8
CD44v8-10
CD44 variant of RA patients
CD44vRA
CD45
CD45iota
CD45(+) liver side population tip cells
CD45R
CD45RO
CD45RA
CD45RB
CD45RC
CD45(-) Sca-1(+) c-kit(-) cells
CD45t
CD46
CD47
CD47R
CD48
CD49
CD49a
CD49b
CD49c
CD49d
CD49e
CD49f
CD50
CD51
CD52
CD53
CD54
CD54(+) neutrophils
CD55
CD55a
CD55b
CD56
CD56(bright) NK-cells
CD56(dim) NK-cells
CD56(dim) CD16(+) NK-cells
CD56(dim) CD16(bright) NK-cells
CD57
CD58
CD59
CD59a
CD59b
CD60
CD60a
CD60b
CD60c
CD61
CD61A
CD62
CD62E
CD62L
CD62P
CD63
CD64
CD65
CD65s
CD66
CD66a
CD66b
CD66c
CD66d
CD66e
CD66f
CD67
CD68
CD69
CD70
CD71
CD71(+) erythroid cells
CD72
CD72a
CD72b
CD72c
CD73
CD74
CD75
CD75s
CD77
CD77 synthase
CD79a
CD79-alpha
CD79b
CD79-beta
CD80
CD81
CD81 partner 3
CD81P3
CD82
CD83
CD83a
CD83b
CD83c
CD84
CD84-H1
CD84 homolog 1
CD85
CD85a
CD85b
CD85c
CD85d
CD85e
CD85f
CD85g
CD85h
CD85i
CD85j
CD85k
CD85l
CD85m
CD86
CD86deltaTM
CD87
CD88
CD89
CD89b
CD90
CD91
CD92
CD93
CD94
CD94C
CD94-T4
CD95
CD95L
CD95 ligand
CD96
CD97
CD97a
CD97-alpha
CD97b
CD97-beta
CD98
CD98HC
CD98LC
CD99
CD99 antigen-like 2
CD99 antigen-like 2(223-246)
CD99b
CD99L2
CD99L2(223-246)
CD99R
CD100
CD100 receptor
CD101
CD102
CD103
CD104
CD105
CD106
CD106(+) macrophages
CD107a
CD107 antigen-like family member A
CD107 antigen-like family member B
CD107b
CD108
CD109
CD110
CD111
CD112
CD113
CD114
CD115
CD116
CD117
CD118
CD119
CD120a
CD120b
CD121
CD121a
CD121b
CD122
CD123
CD124
CD125
CD126
CD127
CD128
CD129
CD130
CD131
CD132
CD133
CD133(+) cells
CD134
CD134L
CD134 ligand
CD135
CD136
CD137
CD137L
CD137 ligand
CD138
CD139
CD140a
CD140b
CD141
CD142
CD143
CD144
CD146
CD147
CD148
CD149
CD150
CD151
CD152
CD152L
CD153
CD154
CD155
CD155-alpha
CD155-beta
CD155-delta
CD155-gamma
CD156
CD156a
CD156b
CD156c
CD157
CD158
CD158a
CD158b
CD158b1
CD158b2
CD158c
CD158d
CD158E1
CD158g
CD158h
CD158i
CD158j
CD158k
CD158z
CD159a
CD159c
CD160
CD161
CD161a
CD161b
CD161c
CD161d
CD16-2
CD162
CD163
CD163 antigen-like 1
CD163b
CD163b-alpha
CD163b-beta
CD163c-alpha
CD163L1
CD164
CD164(E1-6)
CD164L1
CD165
CD166
CD167
CD167a
CD167b
CD168
CD169
CD170
CD171
CD172A
CD172B
CD172G
CD173
CD175
CD175s
CD176
CD177
CD178
CD179
CD179a
CD179a/b
CD179b
CD180
CD181
CD182
CD183
CD184
CD185
CD186
CD191
CD192
CD193
CD194
CD195
CD196
CD197
CD200
CD200R
CD200R1
CD200R1L
CD200R2
CD200R3
CD200R4
CD200 receptor
CD200 receptor 1
CD200 receptor 1-like
CD200 receptor 2
CD200 receptor 3
CD200 receptor 4
CD200RLa
CD200RLb
CD200RLc
CD200 receptor-like 2
CD200 receptor-like 3
CD200 receptor-like 4
CD201
CD202
CD202B
CD203c
CD204
CD205
CD206
CD207
CD208
CD209
CD209a
CD209 antigen-like protein A
CD209 antigen-like protein B
CD209 antigen-like protein C
CD209 antigen-like protein D
CD209 antigen-like protein E
CD209b
CD209c
CD209d
CD209e
CD209L
CD209L1
CD209-like
CD209-like-1
CD210
CD210a
CD212
CD212b1
CD213a1
CD213a2
CD215
CD217
CD218a
CD218b
CD220
CD221
CD22.1
CD222
CD22.2
CD223
CD224
CD225
CD226
CD227
CD228
CD229
CD230
CD231
CD232
CD233
CD234
CD235a
CD235b
CD236
CD236R
CD238
CD239
CD240CE
CD240D
CD241
CD242
CD243
CD244
CD245
CD246
CD247
CD248
CD249
CD252
CD253
CD254
CD256
CD257
CD258
CD261
CD262
CD263
CD264
CD265
CD266
CD267
CD268
CD269
CD270
CD271
CD272
CD273
CD274
CD275
CD276
CD277
CD277/BTN3A
CD278
CD279
CD280
CD281
CD282
CD283
CD284
CD286
CD288
CD289
CD290
CD292
CD294
CD295
CD296
CD297
CD298
CD299
CD300A
CD300 antigen-like family member H
CD300B
CD300C
CD300C-like molecule
CD300D
CD300E
CD300F
CD300 family
CD300H
CD300LB
CD300LD
Cd300ld3
CD300LE
CD300LF
CD300LG
Cd300lh
CD300 molecule-like family member B
CD300 molecule-like family member D
CD300 molecule-like family member D3
CD300 molecule-like family member F
CD300 molecule-like family member G
CD300 molecule-like family member LE
CD301
CD301a
CD301b
CD302
CD303
CD304
CD305
CD306
CD307
CD307a
CD307b
CD307c
CD307d
CD307e
CD309
CD312
CD314
CD315
CD316
CD317
CD318
CD319
CD320
CD321
CD322
CD324
CD325
CD326
CD327
CD328
CD329
CD330
CD331
CD332
CD333
CD334
CD335
CD336
CD337
CD338
CD339
CD340
CD344
CD349
CD350
CD351
CD352
CD353
CD354
CD355
CD357
CD358
CD360
CD361
CD362
CD363
CD364
CD365
CD366
CD367
CD368
CD369
CD370
CD371
CD45.1
CD45.2
CD133-1
CD133-2
CD87(84-95)
CD74(81-104)
CD56(515-531)
CD56(529-544)
CD56(545-559)
CD56(561-573)
CD56(573-586)
CD56(589-599)
CD74(103-117)
CD antigens
CD antigens Dictionary
CDAF
CDAMPs
CDAP-4
C/D Box RNAs
C/D Box small nucleolar RNAs
CDCNGRCFC
cDCs
CDC genes
CDCP1
CDCREL-2
CDD
CDD/ANP[1-126]
CDD/ANP[95-126]
CDD/ANP[99-126]

CĂ16-argilin
CĂ16-augurin

CDEs
CDF
cdf
CDF/LIF
CD-GCAP
CD-GF
CDGF
CDGF-1
CDGF-1.7
CDH
CDH1
CDH2
CDH5
CDH6
CDH6B
CDH13
CDHF5
CDHF12
CDHH
CDHN
CDHR16
CDI
CDIP
CDIP1
CDIP-2
CDIR
CDK5-binding protein
CDK5/p35-regulated kinase
CDKPPYLPRPRPPRRIYNRamide
CDM
CDMP
CDMP-1
CDMP-2
CDMP-3
cDNA
cDNA-PCR
cDNA subtraction
CDNF
CDOPs
CDP I
CDP II
CDP III
CDPs
CD-RAP
C/D RNAs
CDT
CDT6
CDTA
CDTB
CDTC
CDTRL
CDW2
CDw12
CDw17
CDw40
CDw44
CDw60
CDw75
CDw76
CDw84
CDw92
CDw108
CDw113
CDw116
CDw125
CDw127
CDw128a
CDw128b
CDw130
CDw131
CDw136
CDw137
CDw149
CDw150
CDw156c
CDw186
CDw197
CDw198
CDw199
CDw210
CDw210a
CDw210b
CDw217
CDw218a
CDw218b
CDw293
CDw325
CDw327
CDw328
CDw329
CDy1

ce
CE-9
CEA
CEA2
CEA3
CEA11
CEACAM1
CEACAM2
CEACAM3
CEACAM5
CEACAM6
CEACAM8
CEACAM1-1L
CEACAM1-3
CEACAM1-3AL
CEACAM1-3AS
CEACAM1-3C2
CEACAM1-3L
CEACAM1-3S
CEACAM1-4C1
CEACAM1-4L
CEACAM1-4S
CEACAM3-1
CEACAM3-1C1
CEACAM3-1L
CEACAMPS
CEA gene family member 1
CEA gene family member 1a
CEA gene family member 1b
CEA gene family member 1c
CEA gene family member 2
CEA gene family member 6
CEAL
CEA-like protein
CEAP
CEAP-11
CEAP-16
CEA-related cell adhesion molecule 1
CEA-related cell adhesion molecule 2
CEA-related cell adhesion molecule 3
CEA-related cell adhesion molecule 5
CEA-related cell adhesion molecule 6
CEA-related cell adhesion molecule 8
CEase
ceb
ceBNIP3
C/EBP-beta
C/EBP-homologous protein
C/EBP-homologous protein-10
C/EBP-related protein-2
C/EBP-zeta
CECs
CecA
CecA1
CecA2
CecAD
CecB
CecC
CecD
CecE
CecF
CecG
CecP
cecP1
CECR1
Cecropin A
Cecropin A1
Cecropin A2
Cecropin A(1-33)
cecropin AD
Cecropin B
Cecropin C
Cecropin D
Cecropin D1
cecropin D2
Cecropin E
Cecropin F
Cecropin G
Cecropin P1
Cecropin P2
Cecropin P3
Cecropin P4
cecropins
cecropin-TY1
cecropin XJ
CED1
CED2
CED3
CED3/ICH-1 prodomain homologous E10-like regulator
CED3-like/NEDD2-like protein
CED3 protease suppressors
CED3 protease suppressor-1
CED3 protease suppressor-2
CED3 protease suppressor-3
CED3 protease suppressor-4
CED3 protease suppressor-5
CED3 protease suppressor-6
CED4
CED4L
CED4S
CED5
CED6
CED6 homolog
CED7
CED8
CED9
CED10
CED12
CEECAM1
CEF-4
CEF-10
CEF-derived growth factor
CEG1
CEGB1
CEGF1
CEGF3
CEGP1
CEH
Cek1
Cek2
Cek3
Cek4
Cek5
Cek5 ligand
Cek6
Cek7
Cek7 ligand
Cek9
Cek10
CEL
CELF2
CELISA
Cell ablation
Cell activation
cell adhesion kinase
cell aggregates
cell-autonomous death
cell binding protein 2
Cell blot assay
Cell-CAM
cell-CAM 105
cell-cell adhesion molecule
cell-cell adhesion molecule 1
cell-cell adhesion molecule 1a
cell-cell adhesion molecule 1b
cell-cell adhesion molecule 2
cell-cell adhesion molecule 2a
cell-cell adhesion molecule 2b
cell-cell adhesion molecule 105
cell-cell cannibalism
Cell competition
cell competition-induced apoptosis
cell culture
cell culture wound closure assay
cell culture wounding assay
Cell cycle
cell cycle and apoptosis regulatory protein 1
cell cycle centrosome associated protein
Cell cycle control genes
cell cycle exit and neuronal differentiation 1
cell cycle gene 2
cell cycle therapy
cell death
Cell death abnormality protein 1
Cell death abnormality protein 2
Cell death abnormality protein 8
Cell death abnormality protein 12
cell death activator CIDE-A
cell death activator CIDE-B
cell death activator CIDE-C
Cell death and apoptosis Dictionary
cell death-associated molecular patterns
cell death caspases
Cell Death Dictionary
Cell death-inducing DFF45-like effector
Cell death-inducing DFF45-like effector-3
Cell death-inducing DFF45-like effector-3-alpha
Cell death-inducing DFF45-like effector A
Cell death-inducing DFF45-like effector B
Cell death-inducing DFF45-like effector C
cell death inhibiting RNA
Cell death-inducing p53-target protein 1
Cell Death Involved p53-target
cell death proteases
Cell death protein 3
Cell death protein 4
Cell death protein 6
Cell death protein 7
Cell death protein 9
Cell death protein 10
cell death-related nuclease-1
cell death-related nuclease-2
cell death-related nuclease-3
cell death-related nuclease-4
cell death-related nuclease-5
cell death-related nuclease-6
cell death-related nucleases
Cell Death Specification-1
Cell Death Specification-2
Cell death suppressors
cell-derived vesicles
Cell division control-related protein 2
Cell-free culture supernatant
Cell-free DNA
cell-free RNAs
Cell growth-inhibiting gene 8
Cell growth-inhibitory factor
cell homing peptides
Cell immortalization-related protein 2
cell-in-cell death
cell-in-cell invasion
cell-in-cell structures
cell-internalizating peptides
cell internalization peptides
cell lineage
Cell lines in Cytokine Research
Cell migration-inducing and hyaluronan-binding protein
Cell migration-inducing gene 10 protein
cell migration inducing protein
cell migration-inducing protein 20
cell motility assay
cell of origin of a tumor
Cell passage
Cell-penetrating peptides
cell-permeable peptides
cell plasticity
cell polarity
cell polarization
Cell proliferation-inducing gene 2 protein
Cell proliferation-inducing gene 32 protein
cell regulatory sialoglycopeptide 18 kDa
Cell reprogramming
Cell scattering factors
cells of Boettcher
cells of Claudius
cells of Corti
cells of Dogiel
cells of Hensen
cells of Landau
cells of renin lineage
cells of undetermined significance
cell proliferation-inducing gene 15 protein
Cell-specific gene expression
Cells-Talk on Social Media
cell surface ATP Synthase
cell surface retention signal
Cell surface retention sequence binding protein-1
cell-targeting peptides
cell transformation
Cell types Dictionary
cellular adhesion molecule L1
Cellular adhesion molecule regulatory factor
cellular apoptosis susceptibility gene
Cellular cannibalism
Cellular communication
cellular enzyme-linked immunosorbent assay
cellular fibronectin
cellular FLICE-inhibitory protein
cellular hormones
cellular inhibitor of apoptosis-1
cellular inhibitor of apoptosis-2
cellular oncogene
cellular repressor of E1A-stimulated genes
cellular repressor of E1A-stimulated genes 1
cellular repressor of E1A-stimulated genes-2
Cellular reprogramming
cellular retinoid binding protein
cellular snake venom-like protease
CELO virus 9R1 protein
cement cells
cementoblasts
cementoclasts
cementocytes
Cementum-derived growth factor
Cementum mitogenic factor
CEMF
Ce-MIF
Ce-MIF-1
Ce-MIF-2
Ce-MIF-3
Ce-MIF-4
Ce-MIF-5
CEMIP
CEMP cells
CEND1
Cenderitide
CendR motif
CendR peptides
C-end Rule motif
C-end Rule peptides
CENP-B
CENP-S
central brain deranged
central cells
central macrophage
central Memory T-cells
central missing
central regulatory T-cells
central Tregs
centroacinar cells
centroblasts
centrocin 1
centrocin 2
centrocins
centrocytes
centromere autoantigen B
centromere protein B
centromeric protein S
centrosome-associated protein
CEP7
CEP68
CEP-1347
cephalic hedgehog
cephalotocin
CEPR
CEPU-1
CEPUS
CEPU-Se-A
CER1
cer-1
Ceramide dihexoside
Ceramide dodecasaccharide
ceramide trihexoside
ceratotoxin A
ceratotoxin B
ceratotoxin C
ceratotoxin D
ceratotoxins
c-erb
c-erbA
c-erbB
c-erbB1
c-erbB2
c-erbB3
c-erbB4
Cerberus
Cerberus-1
Cerberus-2
cerberus-related-1
CERCAM
C-ERC/mesothelin
cerebellar deficient folia
cerebellar vermis defect
Cerebellin
cerebellin-1
cerebellin-2
cerebellin-3
cerebellin-4
Cerebellin-like glycoprotein 1
cerebellin precursor protein 1
cerebellins
cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy
cerebral cavernous malformation 3
cerebral cell adhesion molecule
cerebral dopamine neurotrophic factor
Cerebral endothelial cell adhesion molecule
Cerebral endothelial cell adhesion molecule 1
Cerebral organoids
Cerebral Peptide 1
Cerebral Peptide 2
cerebral perivascular macrophages
Cerebral protein 7
Cerebral vascular amyloid peptide
Cerebrin
Cerebroglycan
Cerebroside sulfate activators
cerebrospinal fluid-contacting neurons
cereolysin A
cereolysin AB
CeReS-18
ceRNAs
Cerr1
Cerulein
Ceruletide
ceruloplasmin
cervical cancer suppressor 3
cervical mucus inhibitor
CES-1
CES-2
Ce-sema-2a
CESS
CET-1
CETAF
CETPI(474-491)
Cetuximab
c-eyk

CF
CF2R
CFAG
CF antigen
CFAP299
CFB
CFC
CFC1
CFC-B
CFC-Eo
CFC family
CFC-G
CFC-GM
CFC-M
CFC-Mix
CFCS
CFD
cfDNA
c-fes
CFFQNCPRGamide
CFFRNCPPGamide
c-fgr
CFH
C-fibers
CFIRNCPKGamide
CFISNCPKGamide
CFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQ
CFLAR
c-FLIP
cFLIPp43
CFLNSCPYRRYamide
c-fms
c-fos
CFP
CfPGRP-S1
c-fps
CFR
CFR-1
cfRNAs
CFS
CFSH
CFSH 1
CFSH 2
CFTL-12
CFTL-15
CFTR
CFU
CFU-A
CFU-ALP
CFU-AP
CFU-B
CFU-Ba
CFU-Bas
CFU-C
CFU-DC
CFU-E
CFU-EC
CFU-Eo
CFU-Eo GSF
CFU-F
CFU-G
CFU-G inhibitory factor
CFU-GEMM
CFU-GM
CFU-Hill
CFU-LT
CFU-M
CFU-Mast
CFU-MEG
CFU-Mix
CFU-Mk
CFU-O
CFU-OB
CFU-RF
CFU-S
CFU-SA
CFU-SF
CFU-s inhibitory activity
CFU-s MF
CFU-s SF
CFU-T
CFVRNCPTGamide
CFWTSCPIGamide
CFWTTCPIGamide

CG
CG1028
CG1081
CG1130
CG1147
CG1171
CG1200
CG1221
CG1274
CG1361
CG1365
CG1367
CG1373
CG1385
CG1502
CG1505
CG1634
CG1708
CG1775
CG1804
CG1838
CG1857
CG1862
CG1871
CG1878
CG1891
CG1901
CG1921
CG1975
CG2047
CG2078
CG2081
CG2086
CG2114
CG2125
CG2171
CG2189
CG2210
CG2264
CG2346
CG2411
CG2647
CG2671
CG2872
CG3048
CG3135
CG3260
CG3302
CG3313
CG3441
CG3584
CG3619
CG3653
CG3665
CG3707
CG3727
CG3869
CG3878
CG3903
CG3936
CG4007
CG4099
CG4144
CG4164
CG4201
CG4262
CG4272
CG4280
CG4319
CG4345
CG4427
CG4432
CG4437
CG4531
CG4608
CG4626
CG4637
CG4651
CG4700
CG4740
CG4845
CG4881
CG4889
CG4910
CG4920
CG4926
CG4974
CG5008
CG5123
CG5249
CG5370
CG5383
CG5400
CG5403
CG5408
CG5462
CG5490
CG5504
CG5528
CG5562
CG5575
CG5576
CG5609
CG5661
CG5680
CG5778
CG5791
CG5811
CG5837
CG5848
CG5896
CG5911
CG5911a
CG5911b
CG5912
CG5974
CG5988
CG5992
CG5993
CG5998
CG6054
CG6122
CG6124
CG6134
CG6151
CG6210
CG6232
CG6303
CG6367
CG6371
CG6440
CG6446
CG6449
CG6456
CG6464
CG6496
CG6515
CG6531
CG6667
CG6736
CG6794
CG6827
CG6829
CG6863
CG6868
CG6890
CG6895
CG6936
CG6986
CG7013
CG7097
CG7103
CG7105
CG7147
CG7221
CG7223
CG7228
CG7250
CG7285
CG7395
CG7486
CG7490
CG7496
CG7533
CG7590
CG7629
CG7649
CG7665
CG7793
CG7863
CG7887
CG7904
CG7926
CG7996
CG8091
CG8167
CG8175
CG8222
CG8224
CG8238
CG8250
CG8293
CG8348
CG8355
CG8357
CG8400
CG8422
CG8428
CG8458
CG8561
CG8577
CG8581
CG8595
CG8742
CG8784
CG8795
CG8827
CG8830
CG8896
CG8930
CG8942
CG8967
CG8982
CG8985
CG8995
CG9015
CG9032
CG9046
CG9211
CG9345
CG9414
CG9450
CG9621
CG9681
CG9697
CG9739
CG9885
CG9918
CG9972
CG10079
CG10080
CG10143
CG10146
CG10197
CG10233
CG10325
CG10334
CG10342
CG10379
CG10388
CG10473
CG10491
CG10520
CG10521
CG10626
CG10658
CG10593
CG10698
CG10719
CG10776
CG10794
CG10810
CG10812
CG10816
CG10823
CG10917
CG10944
CG10967
CG11051
CG11062
CG11081
CG11086
CG11111
CG11228
CG11129
CG11325
CG11495
CG11501
CG11547
CG11561
CG11648
CG11680
CG11709
CG11798
CG11989
CG11992
CG12072
CG12265
CG12284
CG12297
CG12306
CG12370
CG12399
CG12443
CG12537
CG12763
CG12918
CG12919
CG13061
CG13072
CG13076
CG13094
CG13187
CG13194
CG13317
CG13419
CG13480
CG13521
CG13574
CG13633
CG13648
CG13687
CG13701
CG13702
CG13756
CG13780
CG13781
CG13782
CG13803
CG13936
CG13936-PB peptide
CG13936-PD peptide
CG13968
CG14026
CG14027
CG14049
CG14059
CG14141
CG14167
CG14173
CG14225
CG14226
CG14358
CG14375
CG14484
CG14575
CG14593
CG14637
CG14704
CG14734
CG14745
CG14746
CG14821
CG14869
CG14871
CG14902
CG14919
CG15009
CG15062
CG15065
CG15066
CG15067
CG15068
CG15105
CG15110
CG15231
CG15284
CG15361
CG15427
CG15437
CG15479
CG15520
CG15671
CG15727
CG15917
CG16705
CG16707
CG16712
CG16752
CG16785
CG16836
CG16844
CG16857
CG16873
CG16876
CG16910
CG16987
CG17245
CG17415
CG17610
CG17673
CG17697
CG17800
CG17878
CG18090
CG18105
CG18106
CG18107
CG18108
CG18188
CG18279
CG18321
CG18372
CG18405
CG18657
CG30040
CG30106
CG31193
CG31217
CG31507
CG31508
CG31509
CG31691
CG31695
CG31762
CG32042
CG32120
CG32134
CG32146
CG32178
CG32179
CG32185
CG32268
CG32279
CG32282
CG32283
CG32491
CG32535
CG33103
CG33117
CG33134
CG33193
CG33273
CG33470
CG33525
CG33527
CG33696
CG33706
CG33717
CG33960
CG33990
CG34381
CG34388
CG40041
CG40733
CG42281
CG42301
CG42576
CG42636
CG42687
CG43202
CG77880
CG9224
CG13781/13782
CGA
CgA(1-76)
CgA(1-113)
CgA(1-128)
CgA(36-44)
CgA(47-66)
CgA(19-146)
CgA(116-207)
CgA(116-301)
CgA(124-143)
CgA(134-225)
CgA(142-161)
CgA(176-195)
CgA(191-212)
CgA(210-252)
CgA(210-301)
CgA(228-260)
CgA(250-288)
CgA(250-301)
CgA(254-301)
CgA(272-319)
CgA(273-301)
CgA(304-321)
CgA(316-329)
CgA(322-339)
CgA(324-331)
CgA(324-337)
Cga(334-347)
CgA(340-358)
CgA(342-349)
CgA(342-355)
CgA(344-358)
CgA(344-364)
CgA(347-419)
CgA(352-372)
CgA(358-376)
CgA(360-373)
CgA(362-372)
CgA(363-435)
CgA(364-384)
CgA(367-387)
CgA(367-391)
CgA(375-393)
CgA(380-390)
CgA(393-411)
CgA(395-438)
CgA(402-438)
CgA(403-428)
CgA(413-456)
CgA(420-456)
cGAMP synthase
CGA-N8
CGA-N12
CGA-N15
CGA-N16
CGA-N46
cGAS
CGB
CGB1
CGB2
CGB3
CGB4
CGB5
CGB6
CGB7
CGB8
CgB(420-493)
CgB(440-513)
CGB(498-517)
CgB(555-565)
CgB(567-580)
CGB(568-577)
CGB(580-593)
CgB(597-653)
CgB(614-626)
CgB(617-673)
CgB(634-646)
CGC
CG-beta-a
Cg-Def
CGEMGWVRC
CGF
CGFECVRQCPERC
CGFELETC
CGFYWLRSC
CGGKVGKACCVPTKLSPISVLYK
CGH
CGI-01
CGI-45
CGI-119
CGIF
CGKRK
CGL1
CGL2
CGLA
CGLB
CGLIIQKNEC
Cglosin-1
Cglosin-2
C-glucagon
CGM1
CGM1a
CGM1b
CGM1c
CGM2
CGM6
cgMolluscidin
CGMP
cGMPs
CGNKRTR
CGNKRTRGC
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
CGNSNPKSC
CGP
CGP-39
CGP41251
CgPGRP-S1S
CgPGRP-S1L
CgPGRP-S2
CgPGRP-S3
CGPGTKKVHVIFNYKGKNVLINKDIRC
Cg-Prp
CgrA
CgrB
CgrC
CGRP
CGRP1
CGRP2
CGRP[8-37]
CGRP-alpha
CGRP-beta
cgRPL29
CGRP neurons
CGRPR
CGRP-receptor component protein
CGRP-RCP

Ch
Ch21
CH925
CHA(31-76)
chaC
CHAC1
chain fibers
CHAK
chalice cells
chandelier cells
Chapare virus Z protein
Chaperokine
Chaperone-assisted selective autophagy
Chaperone-mediated autophagy
Chaperones
chaperonin
chaperonin 10
chaperonin 60
chaperonin 10(120)
Charcot-Leyden crystal protein 2
charged multivesicular body protein 3
Charged multivesicular body protein 5
charged MVB protein-5
Charlatan
charontosis
charybde
charybdis
ChAT development factor
CHb-1
CHb-2
CHBL2
Ch blood group antigen
CHBP
chCCLi1
chCCLi2
chCCLi3
chCCLi4
chCCLi7
CHCHD5
Chd
cHDGF
Ch-DGF
ChDI
CH domain
Che-1
CHEASAAQC
CHEC-9
Chediak-Higashi syndrome 1
Cheesy necrosis
Chemerin
chemerin-9
Chemerin-15
Chemerin(149-157)
Chemerin-derived C-20 peptide
chemerinR
chemerin receptor
chemerin receptor 1
chemerin receptor 2
chemerin receptor 23
chemoattractant receptor 23
chemoattractant receptor-homologous molecule expressed on Th2 cells
chemoattractants
chemoinvasion
Chemokine 2
chemokine 25
chemokine alpha 3
chemokine-alpha receptor 1
chemokine-alpha receptor 2
Chemokine-beta-1
Chemokine-beta-4
Chemokine-beta-6
Chemokine-beta-7
Chemokine-beta-8
Chemokine-beta-9
Chemokine-beta-10
Chemokine-beta-11
Chemokine-beta-12
Chemokine-beta-15
Chemokine-beta-8-1
chemokine-beta receptor 1
chemokine-beta receptor 2
chemokine-beta receptor 3
chemokine-beta receptor 4
chemokine-beta receptor 5
chemokine-beta receptor 6
chemokine-beta receptor 7
chemokine-beta receptor 8
chemokine-beta receptor 9
chemokine beta receptor-like-1
Chemokine binding protein-1
chemokine binding protein-2
chemokine binding proteins
Chemokine binding protein type 1
Chemokine binding protein type 2
chemokine (C-C motif) ligand 1
chemokine (C-C motif) ligand 2
chemokine (C-C motif) ligand 3
chemokine CC Motif Ligand 3-like protein 1
chemokine CC Motif Ligand 3-like protein 2
chemokine CC Motif Ligand 3-like protein 3
chemokine (C-C motif) ligand 4
chemokine (C-C motif) ligand 5
chemokine (C-C motif) ligand 6
chemokine (C-C motif) ligand 7
chemokine (C-C motif) ligand 8
chemokine (C-C motif) ligand 9
chemokine (C-C motif) ligand 10
chemokine (C-C motif) ligand 11
chemokine (C-C motif) ligand 12
chemokine (C-C motif) ligand 13
chemokine (C-C motif) ligand 14
chemokine (C-C motif) ligand 15
chemokine (C-C motif) ligand 16
chemokine (C-C motif) ligand 17
chemokine (C-C motif) ligand 18
chemokine (C-C motif) ligand 19
chemokine (C-C motif) ligand 20
chemokine (C-C motif) ligand 21
chemokine (C-C motif) ligand 22
chemokine (C-C motif) ligand 23
chemokine (C-C motif) ligand 24
chemokine (C-C motif) ligand 25
chemokine (C-C motif) ligand 26
chemokine (C-C motif) ligand 27
chemokine (C-C motif) ligand 28
Chemokine CC Receptor-like-1
Chemokine CC Receptor-like-2
Chemokine CC Receptor-like-2A
Chemokine CC Receptor-like-2B
chemokine C motif ligand-1
chemokine C motif ligand-2
chemokine (C-X-C motif) ligand 1
chemokine (C-X-C motif) ligand 2
chemokine (C-X-C motif) ligand 3
chemokine (C-X-C motif) ligand 4
chemokine (C-X-C motif) ligand 5
chemokine (C-X-C motif) ligand 6
chemokine (C-X-C motif) ligand 7
chemokine (C-X-C motif) ligand 8
chemokine (C-X-C motif) ligand 9
chemokine (C-X-C motif) ligand 10
chemokine (C-X-C motif) ligand 11
chemokine (C-X-C motif) ligand 12
chemokine (C-X-C motif) ligand 13
chemokine (C-X-C motif) ligand 14
chemokine (C-X-C motif) ligand 15
chemokine (C-X-C motif) ligand 16
chemokine (C-X-C motif) ligand 17
chemokine decoy receptors
chemokine-derived antimicrobial peptide-4
chemokine-derived inhibitory peptide-2
chemokine interceptors
chemokine-internalizing proteins
chemokine-like factor
chemokine-like factor-1
chemokine-like factor-2
chemokine-like factor-3
chemokine-like factor-4
chemokine-like factor-5
chemokine-like factor-6
chemokine-like factor superfamily member 1
chemokine-like factor superfamily member 2
chemokine-like factor superfamily member 3
chemokine-like factor superfamily member 4
chemokine-like factor superfamily member 5
chemokine-like factor superfamily member 6
chemokine-like factor superfamily member 7
chemokine-like factor superfamily member 8
chemokine-like functions
Chemokine-like Protein B42
Chemokine-like Protein N73
chemokine-like receptor 1
chemokine N1
chemokine orphan receptor 1
chemokine receptor 1
chemokine receptor 2
chemokine receptor 5
chemokine receptor 13
chemokine receptor 23
chemokine receptor expressed in activated monocytes
chemokine receptor expressed in activated monocytes A
chemokine receptor expressed in activated monocytes B
chemokine receptor L1
chemokine receptor L2
chemokine receptor L3
chemokine receptor-like 2
chemokine receptor X
Chemokines
chemokinesis
chemokinetic inhibitory factor
chemokine with 6 cysteines
Chemokinostatin-1
Chemokinostatin-3
Chemokinostatin-5
Chemokinostatin-6
Chemokinostatin-7
Chemokinostatin-8
chemokinostatins
chemorepellent
chemorepulsion
chemotactic and angiogenic factor
chemotactic cytokines
chemotactic deactivation
chemotactic factor
chemotactic index
chemotactic monokine
chemotactic protein 10
chemotaxin
chemotaxin/interleukin 8
chemotaxis
chemotaxis inhibitory protein of Staphylococcus aureus
chemotoxins
ChemR1
ChemR13
ChemR23
Chensinin-1
cheRNAs
cheY
CHF
CHGA
CHGB
CHGC
Chh
CHH
CHH-A
CHH-B
CHH-I
CHH-II
CHH precursor-related peptide
CHI3L1
CHI3L2
CHI3L3
Chi3l4
CHIAMP
chick aortic arch assay
Chick brain-derived growth factor
Chicken acidic leucine-rich EGF-like domain-containing brain protein
chicken anemia virus VP3 protein
chicken chemotactic and angiogenic factor
Chicken chorioallantoic membrane assay
Chicken embryo fibroblast-derived growth factor
chicken embryonic kinase 1
chicken embryonic kinase 2
chicken embryonic kinase 3
chicken embryonic kinase 4
chicken embryonic kinase 5
chicken embryonic kinase 5 ligand
chicken embryonic kinase 6
chicken embryonic kinase 7
chicken embryonic kinase 7 ligand
chicken embryonic kinase 9
chicken embryonic kinase 10
chicken GNRH2
chicken heterophil peptide 1
chicken heterophil peptide 2
chicken matrix metalloproteinase
Chicken muscle growth factor
chicken myeloid antimicrobial peptide 27
Chicken myelomonocytic growth factor
chicken RING zinc finger
Chido blood group antigen
Chido/Rodgers blood group
chief cells
Chikungunya virus TF protein
Chil1
Chil3
Chil4
chilblain lupus 2
childhood-onset Polyarteritis nodosa
Chilectins
CHILP
Chimaeric antigen receptor T-cells
Chinese hamster ovary
Chionodracine
CHIP
CHIPS
chitinase 3-like-1
chitinase 3-like-2
chitinase 3-like-3
chitinase 3-like 4
Chitinase-3-like protein 1
Chitinase-3-like protein 4
chitinase-like 1
Chitinase-like protein 3
Chitinase-like protein 4
CHK
CHL
CHL1
CHL2
chlamydial protease-like activity factor
Chlamydia protein Associating with Death Domains
Chlamys farreri PGRP
chloragocytes
chloragogen cells
Chlorella virus viroporins
chloride cells
Chloroacetylcarbamoyl-Fumagillol
ChM-1
ChM1L
ChM-2
ChM-3
CHMP3
CHMP family member 3
CHMP5
CHMS-1
Chn
CHN
CHO
choanocytes
cholangiocytes
Cholecystokinin
Cholecystokinin-1 receptor
Cholecystokinin-2 receptor
Cholecystokinin-4
Cholecystokinin-5
Cholecystokinin-7
Cholecystokinin-8
cholecystokinin-8NS
cholecystokinin-8S
Cholecystokinin-9
Cholecystokinin-10
Cholecystokinin-12
Cholecystokinin-18
Cholecystokinin-22
Cholecystokinin-25
Cholecystokinin-33
Cholecystokinin-39
Cholecystokinin-58
Cholecystokinin(21-40)
Cholecystokinin(21-44)
Cholecystokinin B
cholecystokinin cells
Cholecystokinin neurons
Cholecystokinin octapeptide
cholecystokinin/pancreozymin
cholecystokinin releasing peptide
cholecystokinin splice variant
cholerilysins
Cholesterol esterase
Cholesteryl ester transfer protein isoform (474-491)
Choline acetyltransferase development factor
cholinergic amacrine cells
cholinergic amacrines
Cholinergic differentiation factor
Cholinergic neuronal differentiation factor
cholinergic neurons
cholinergic starburst amacrines
choline transporter-like protein 1
choline transporter-like protein 1a
choline transporter-like protein 1b
Chondrex
chondroblasts
chondrocalcin
chondrocalcinosis 1
Chondrocalcinosis with early-onset osteoarthritis
chondroclasts
Chondrocyte activating factor
chondrocyte alkaline phosphatase induction factor
Chondrocyte colony stimulating factor
Chondrocyte-derived inhibitor
Chondrocyte-derived inhibitor of angiogenesis and metalloproteinase activity
chondrocyte-derived osteoprogenitor cells
chondrocyte expressed protein 68
Chondrocyte growth factor
chondrocyte protein YKL40
chondrocytes
chondrogenic progenitor cells
chondroitin sulfate proteoglycan 4
chondroitin sulfate proteoglycan 5
Chondromodulin
Chondromodulin-1
Chondromodulin-1 like protein
Chondromodulin-2
Chondromodulin-3
chondron
chondroprogenitor cells
chondroptosis
Chondrosarcoma-derived growth factor
Chondrosarcoma growth factor
chondrostatin
CHOP
CHOP-10
CHOPPER
chopper cells
chopper neurons
chopper units
Chordin
chordin-like
chordin-like-1
chordin-like-2
Chorioallantoic membrane assay
choriocarcinoma cells
Choriogonadotropin
Choriogonadotropin alpha chain
choroidal cells
choriomammotropin
chorionic gonadotrophin
chorionic gonadotropin
chorionic gonadotropin-alpha
chorionic gonadotropin alpha chain
chorionic gonadotropin-beta(6-40)
chorionic gonadotropin-beta(55-92)
chorionic gonadotropin beta chain
chorionic gonadotropin-beta core fragment
chorionic gonadotropin beta polypeptide 1
chorionic gonadotropin beta polypeptide 2
chorionic gonadotropin beta polypeptide 3
chorionic gonadotropin beta polypeptide 4
chorionic gonadotropin beta polypeptide 5
chorionic gonadotropin beta polypeptide 6
chorionic gonadotropin beta polypeptide 7
chorionic gonadotropin beta polypeptide 8
chorionic gonadotropin free beta subunit
chorionic somatomammotropin
chorionic somatomammotropin(101-113)
chorionic somatomammotropin A
chorionic somatomammotropin B
chorionic somatomammotropin CS-5
chorionic somatomammotropin hormone 1
chorionic somatomammotropin hormone 2
Chorionic somatomammotropin hormone-like 1
Chorionic somatomammotropin hormone-like 1(83-96)
Chorionic somatomammotropin-like
chorionic somatomammotropins
chp
CHP 1
CHP-1 peptide
CHP 2
CHP-2 peptide
CHP-3 peptide
CHP-4 peptide
Ch-Penaeidin
CHRD
CHRDL1
CHRDL2
Ch/Rg antigen
CHRNA7
Chromacin
chromaffin
chromaffin cells
chromatin autophagy
chromatin-enriched enhancer RNAs
Chromatin-modifying protein 5
chromatin organization modifier domain
Chromatophagy
chromatophores
chromatophorotropic hormones
chromatophorotropins
chromobindin-4
Chromobindin-8
chromobindin-9
chromobindins
CHROMO domain
Chromofungin
Chromogranin A
chromogranin A (1-76)
chromogranin A (1-113)
chromogranin A (1-128)
Chromogranin(31-76)
chromogranin A (36-44)
chromogranin A (47-66)
chromogranin A (19-146)
chromogranin A (116-207)
Chromogranin A (116-301)
chromogranin A (124-143)
chromogranin A (134-225)
chromogranin A (142-161)
chromogranin A (176-195)
chromogranin A (191-212)
chromogranin A (210-252)
Chromogranin A (210-301)
chromogranin A (228-260)
chromogranin A (250-301)
Chromogranin A (254-301)
Chromogranin A (272-319)
Chromogranin A (273-301)
chromogranin A (304-321)
chromogranin A (316-329)
chromogranin A (322-339)
chromogranin A (324-331)
chromogranin A (324-337)
chromogranin A (334-347)
chromogranin A (340-358)
chromogranin A (342-349)
chromogranin A (342-355)
chromogranin A (344-358)
chromogranin A (344-364)
chromogranin A (347-419)
chromogranin A (352-372)
chromogranin A (358-376)
chromogranin A (360-373)
chromogranin A (362-372)
chromogranin A (363-435)
chromogranin A (364-384)
chromogranin A (367-387)
chromogranin A (367-391)
chromogranin A (375-393)
chromogranin A (380-390)
chromogranin A (393-411)
chromogranin A (395-438)
chromogranin A (402-438)
chromogranin A (403-428)
chromogranin A (413-456)
chromogranin A (420-456)
Chromogranin B
chromogranin B (420-493)
chromogranin B (440-513)
chromogranin B (498-517)
chromogranin B (555-565)
chromogranin B (567-580)
chromogranin B (568-577)
chromogranin B (580-593)
chromogranin B (597-653)
Chromogranin B (614-626)
chromogranin B (617-673)
Chromogranin B (634-646)
Chromogranin C
Chromogranin C(182-214)
Chromogranin C(344-356)
chromophil cells
chromophobe cells
CHROMO shadow domain
chromosome 1 open reading frame 11
chromosome 1 open reading frame 12
chromosome 1 open reading frame 63
chromosome 1 open reading frame 76
chromosome 1 open reading frame 121
chromosome 1 open reading frame 139
chromosome 1 open reading frame 177
chromosome 1 open reading frame 178
chromosome 1 open reading frame 187
chromosome 1 open reading frame 201
chromosome 2 open reading frame 9
chromosome 2 open reading frame 28
chromosome 2 open reading frame 31
chromosome 2 open reading frame 40
chromosome 2 open reading frame 89
chromosome 3 open reading frame 13
chromosome 3 open reading frame 58
chromosome 4 open reading frame 4
chromosome 4 open reading frame 7
chromosome 4 open reading frame 22
chromosome 4 open reading frame 31
chromosome 4 open reading frame 52
chromosome 5 open reading frame 23
chromosome 6 open reading frame 8
chromosome 6 open reading frame 73
chromosome 6 open reading frame 76
chromosome 6 open reading frame 144
chromosome 6 open reading frame 150
chromosome 6 open reading frame 187
chromosome 7 open reading frame 9
chromosome 8 open reading frame 57
chromosome 9 open reading frame 2
chromosome 9 open reading frame 8
chromosome 9 open reading frame 10
chromosome 9 open reading frame 13
chromosome 9 open reading frame 26
chromosome 9 open reading frame 82
chromosome 9 open reading frame 83
chromosome 9 open reading frame 89
chromosome 9 open reading frame 90
chromosome 9 open reading frame 94
chromosome 9 open reading frame 121
chromosome 9 open reading frame 155
chromosome 9 open reading frame 164
chromosome 9 open reading frame 165
chromosome 10 open reading frame 13
chromosome 10 open reading frame 49
chromosome 10 open reading frame 54
chromosome 10 open reading frame 59
chromosome 10 open reading frame 72
chromosome 10 open reading frame 83
chromosome 10 open reading frame 97
chromosome 10 open reading frame 99
chromosome 11 open reading frame 32
chromosome 11 open reading frame 43
chromosome 11 open reading frame 82
chromosome 12 open reading frame 5
chromosome 12 open reading frame 39
chromosome 12 open reading frame 48
chromosome 13 open reading frame 15
chromosome 13 open reading frame 24
chromosome 14 open reading frame 4
chromosome 14 open reading frame 27
chromosome 14 open reading frame 96
chromosome 14 open reading frame 108
chromosome 14 open reading frame 141
chromosome 14 open reading frame 153
Chromosome 14 tachykinin-like peptide 1
chromosome 15 open reading frame 1
chromosome 16 open reading frame 5
chromosome 16 open reading frame 23
chromosome 16 open reading frame 77
chromosome 17 open reading frame 33
chromosome 17 open reading frame 60
chromosome 17 open reading frame 88
chromosome 17 open reading frame 99
chromosome 19 open reading frame 10
chromosome 19 open reading frame 13
chromosome 19 open reading frame 33
chromosome 19 open reading frame 63
chromosome 19 open reading frame 75
chromosome 19 open reading frame 80
chromosome 20 open reading frame 8
chromosome 20 open reading frame 63
chromosome 20 open reading frame 70
chromosome 20 open reading frame 71
chromosome 20 open reading frame 82
chromosome 20 open reading frame 97
chromosome 20 open reading frame 102
chromosome 20 open reading frame 103
chromosome 20 open reading frame 114
chromosome 20 open reading frame 122
chromosome 20 open reading frame 149
chromosome 20 open reading frame 153
chromosome 20 open reading frame 158
chromosome 20 open reading frame 182
chromosome 20 open reading frame 183
chromosome 20 open reading frame 184
chromosome 20 open reading frame 185
chromosome 20 open reading frame 186
chromosome 21 open reading frame 1
chromosome 21 open reading frame 3
chromosome 21 open reading frame 11
chromosome 22 open reading frame 3
Chromosome segregation 1
Chromosome segregation 1-like protein
chromospheres
Chromostatin
Chronic infantile neurologic cutaneous and articular syndrome
Chronic lymphoid leukemia
chronic proliferative dermatitis
chronic senescence
Chrysalin
chrysophsin-1
chrysophsin-2
chrysophsin-3
chrysophsins
CHS1
CHSA-GF
ChSh domain
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
CHTL1
CHTM1
CHUK
chum salmon lectin 1
chum salmon lectin 2
chum salmon lectin 3
chx1
Chymase
Chymase 1
Chymodenin

Ci
CI
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR
cIAP1
cIAP2
cIAP2-MALT1
CIAPIN1
CIAS1
CIBZ
CICD
CICs
CIDE
CIDE-3
CIDE-3-alpha
CIDEA
CIDEB
CIDEC
Cif
CIF
CIF-A
CIF-B
CIFN
CIg
CIG5
CIGB-300
CI globulin
CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR
CIIA
CIIRNCPRGamide
CIK
CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
CIL
Cilia- and flagella-associated protein 299
Ciliary neuronotrophic factor
Ciliary neurotrophic factor
ciliary neurotrophic factor receptor
Ciliary neurotrophic factor receptor-alpha
Ciliary photoreceptor cells
Ciliophagy
CILP
CILP-1
CILP2
CILP(156-175)
CILP2(153-171)
Ci-META4
CIM6PR
CIMD
CIN85
CINC
CINC-1
CINC-2-alpha
CINC-2-beta
CINC-2-beta-like
CINC-3
Cinca syndrome
CINCIN1
Cincinnati cytokine capture assay
C-INSL7
Ciona intestinalis metamorphosis gene 4
Ciona savignyi progranulin-1
cionin
CIP29
CIPAR-1
CIPER
CIPs
CIR2
CIRBP
circadian clock cells
circadian clock neurons
circadian oscillator neurons
circadian pacemaker neurons
circletail
Circovirus type 2 orf3
circRNAs
Circular intronic RNAs
circular RNAs
Circulating Angiogenic Cells
circulating cancer stem cells
circulating CD34(+) cells
circulating endothelial cells
circulating fibrocytes
circulating microRNAs
circulating RNAs
circulating skeletal stem cells
circulating osteoblast-lineage cells
circulating osteogenic precursors
circumsporozoite protein(76-93)
circumsporozoite protein(82-100)
CIRE
CIRFVSIDNKKRNIESSEIG
ciRNAs
CIRP
CIRP(110-125)
CIS
CIS1
CIS2
CIS3
CIS4
CIS6
CISH
CISH1
CISH2
CISH3
CISH4
CISH5
CIS homology domain
CISK
cis-NATs
cis-NAT-siRNAs
Cis Natural antisense transcripts
cis-natural antisense transcript siRNAs
CISP
CISS1
CITA
CITDs
Citrate-isocitrate hydrolyase
Citropin 1.1
Citropin 1.2
Citropin 1.3
citropins
Citrulline-aspartate ligase

c-jun

CK
CK-1
CK3 peptide
CK11
CK15
CK18
CK18 M30
CK18 M65
CK19
CKA-3
CKAAKNK
CKAP4
Ckb1
Ckb4
Ckb6
Ckb7
Ckb8
Ckb9
Ckb10
Ckb11
Ckb12
Ckb15
Ckb8-1
CKBBP1
Ck-beta-1
Ck-beta-4
Ck-beta-6
Ck-beta-7
Ck-beta-8
Ck-beta-9
Ck-beta-10
Ck-beta-11
Ck-beta-12
Ck-beta-15
Ck-beta-8-1
CKBPs
CKDDQNPH
CKGGRAKDC
CKII beta-binding protein 1
c-kit
c-kit ligand
CKLF
CKLF-1
CKLF-1 C19 peptide
CKLF-1 C27 peptide
CKLF-2
CKLF-3
CKLF-4
CKLF-5
CKLF-6
CKLFH
CKLFH1
CKLFH1a
CKLF-like MARVEL transmembrane domain-containing protein 1
CKLF-like MARVEL transmembrane domain-containing protein 2
CKLF-like MARVEL transmembrane domain-containing protein 3
CKLF-like MARVEL transmembrane domain-containing protein 4
CKLF-like MARVEL transmembrane domain-containing protein 5
CKLF-like MARVEL transmembrane domain-containing protein 6
CKLF-like MARVEL transmembrane domain-containing protein 7
CKLF-like MARVEL transmembrane domain-containing protein 8
CKLFSF1
CKLFSF2
CKLFSF2a
CKLFSF2b
CKLFSF3
CKLFSF4
CKLFSF5
CKLFSF6
CKLFSF7
CKLFSF8
CKNEKKNKIERNNKLKQPP
CKR
CKR1
CKR2
CKR3
CKR4
CKR5
CKRAVR
CKR-L1
CKR-L2
CKR-L3
CKRVY
CKS9 peptide
CKSTHDRLC
CKSTHPLSC
CKTSF
CKTSF1B1
CKTSF1B2
CKTSF1B3

CL1
CL-1
CL2
CL-2
CL-3
CL-4
CL-5
CL5
CL6
CL11
CL-11
CL-20
CL-34
CL(39)
CL39
CL42
CL43
CL49
CL100
CL10-3-11
CLA
CLAF
CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD
CLAN
CLAN-A
CLAN-B
CLAN-C
Clan CD cysteine peptidases
CLAN-D
CLAP
Clara Cell 10 kDa protein
Clara cell 16 protein
Clara Cell 17 kDa protein
Clara cell protein
Clara cell phospholipid-binding protein
Clara cell protein 16
Clara cells
Clara cell secretory protein
Clarke cells
Clarke's neurons
CLARP
clasmatodendrosis
Class 1 Aminoacyl-tRNA synthetases
class 1 angiogenic inhibitors
Class-1 cytokine receptor family
Class 1 cytokines
class 1 ECMR
class 1 semaphorins
Class 1 viroporins
Class 2 Aminoacyl-tRNA synthetases
class 2 angiogenic inhibitors
class 2-associated invariant chain peptide
Class-2 cytokine receptor family
class 2 cytokines
class 2 ECMR
class 2 semaphorins
Class 2 viroporins
class 3 ECMR
class 3 semaphorins
class 4 semaphorins
class 5 semaphorins
class 6 ECMR
class 6 semaphorins
class A ephrins
class A G-protein-coupled receptors
Class B basic helix-loop-helix protein 24
Class B basic helix-loop-helix protein 25
Class B basic helix-loop-helix protein 26
Class B basic helix-loop-helix protein 27
class B ephrins
class B G-protein-coupled receptors
Class C G-protein-coupled receptors
Class Ia G-protein-coupled receptors
Class Ib G-protein-coupled receptors
classical brown adipocytes
classically activated Kupffer cells
classically activated macrophages
classically activated microglial cells
classical NF-kappa-B pathway
Classical swine fever virus Npro
Classical swine fever virus N-terminal protease
classical swine fever virus p7 protein
Class Ic G-protein-coupled receptors
classical insect-type defensins
classical monocytes
classic antineutrophil cytoplasmic autoantibody
classical NKT-cells
class II-associated Ii-derived peptide
Class II G-protein-coupled receptors
Class III G-protein-coupled receptors
Class II Kenyon cells
Class II tumor suppressor genes
class I Kenyon cells
Class-I MHC-restricted T-cell-associated molecule
Class I tumor suppressor genes
Class IV G-protein-coupled receptors
Class switching of immunoglobulin heavy chains
Class V G-protein-coupled receptors
clastic cells
clastokines
Claudin-8
Claudin-14
Claudius' cells
clavanin A
clavanin B
clavanin C
clavanin D
clavanin E
clavanins
Clavaspirin
claw paw
CLC
CLC2
CLC/CLF
CLCF1
CLCP1
CLCS
CLDH
CLDN8
CLDN14
CLE
clearance cells
clear cells
clear cells of the sweat gland
clear cells of Toker
cleaved chorionic gonadotropin
cleaved hCG
cleaved kininogen
cleaved PRL
cleaved prolactin
CLEC2A
CLEC2A1
CLEC2B
CLEC2C
CLEC2D
CLEC2G
CLEC2I
CLEC4A
CLEC4C
CLEC4D
CLEC4E
CLEC4J
CLEC4K
CLEC4L
CLEC4M
CLEC4N
CLEC5B
CLEC5C
CLEC-6
CLEC6A
CLEC7A
CLEC9A
CLEC10A
CLEC11A
CLEC11A-alpha
CLEC11A-beta
CLEC12A
CLEC13A
CLEC13B
CLEC13D
CLEC13E
CLEC14A
CLEC15A
clec-60
clec-67
clec-85
clec-87
CLEC-muc
CLECSF3
CLECSF3-alpha
CLECSF3-beta
CLECSF6
CLECSF7
CLECSF8
CLECSF9
CLECSF10
CLECSF11
CLECSF12
CLECSF13
CLECSF14
C-lectin domain
C-lectin type 2 protein
cleft lip/palate-ectodermal dysplasia syndrome
CLF
CLF-1
ClfA
ClfA(221-550)
ClfB
CLG1
CLG2
CLG3
CLG4
CLG5
CLGI
CLI
CLICK1
Climbing fibers
Climp-63
Clinically amyopathic dermatomyositis autoantigen 140 kDa
CLIP
CLIP1
CLIP170
CLIP peptide
CLITNCPRGamide
Clitoria ternatea antimicrobial peptide-1
CL-K1
CLKADKAKC
CLL
CLL-1
CL-L1
CLL-associated antigen KW-7
CLL-associated antigen KW-8
CLL-associated antigen KW-12
CLL-associated nurse-like cells
CL-LK
CLM
CLM1
CLM2
CLM3
CLM4
CLM5
CLM6
CLM7
CLM8
CLM9
CLMF
CLMF1
CLMF2
CLMF p35
CLMF p40
ClnA
Clnk
cloche
clock cells
clock neurons
Clonal hematopoiesis
Clonal hematopoiesis of indeterminate potential
clone 5
clone 6
clone 11
clone 39
clone 42
clone 43
clone 49
clone 17.1
clonogenic assays
Clonogenic cell death
clonogenicity assay
clonogenic neoblasts
Clonorin
Clostridium difficile toxin A
Clostridium difficile toxin B
Clostridium perfringens alpha-toxin
Clostridium perfringens beta-toxin
Clostridium perfringens phospholipase C
clp
CLP
CL-P1
CLP11
CLP-19
ClpB
CLP cells
CLP-2 cells
CLPED1
CLPs
CLPS
CLPS(18-22)
CLR
CLR1.1
CLR12
CLR2.1
CLR5.1
CLR7.1
CLR11.1
CLR11.2
CLR11.3
CLR11.4
CLR16.1
CLR16.2
CLR16.3
CLR17.1
CLR19.1
CLR19.2
CLR19.3
CLR19.4
CLR19.5
CLR19.6
CLR19.7
CLR19.8
CLR19.9
CLR-b
CLR family
CLR-g
CLR/RAMP2
CLR/RAMP3
CLS1
CLSSRLDAC peptide
CLT1
CLU
Club Cell Protein 16
club cells
club cell secretory protein
clue cells
club cell secretory protein-16
clump cells
clump cells of Koganei
clumping factor A
clumping factor B
clumping factors
Clusterin
cluster of differentiation
CLWMDWVTEKNINGHQAKFFAC

CM
CM4
CM15
CM5637
CMA
CMA1
CMAH
CMAP
CMAP27
CMCD
CMECs
CMENSA
c-met
cMG1
CMGF
CMGNKRSAKRPC
CMH-1
CMICs
CMKAR1
CMKAR2
CMKBR1
CMKBR2
CMKBR3
CMKBR4
CMKBR5
CMKBR6
CMKBR7
CMKBR8
CMKBR9
CMKBRL1
CMKLR1
CMKRL2
CMKOR1
CML33
CMLP cells
CMMCs
CMMP
cmn
cMoPs
CMPs
c-MPL
c-MPL ligand
CMP-N-acetylneuraminic acid hydroxylase
CMP-NeuAc hydroxylase
CMP-Neu5Ac hydroxylase
CM-protein I
CMP-sialic acid hydroxylase
CMRF35
CMRF35A
CMRF35A1
CMRF35A2
CMRF35A4
CMRF35A5
CMRF35H
CMRF35H9
CMRF35-like molecule-1
CMRF35-like molecule-2
CMRF35-like molecule-3
CMRF35-like molecule-4
CMRF35-like molecule-5
CMRF35-like molecule-6
CMRF35-like molecule-7
CMRF35-like molecule-8
CMRF35-like molecule-9
CMRF35-like molecule A1
CMRF35-like molecule A2
CMRF35-like molecule A4
CMRF35-like molecule A5
CMRF35-like molecule H
CMRF35-like molecule H9
CM T-cells
CMTM1
CMTM2
CMTM3
CMTM4
CMTM4-v1
CMTM4-v2
CMTM4-v3
CMTM5
CMTM5-v1
CMTM6
CMTM7
CMTM8
CMTM8-v2
CMTRIB
CMTX4
CMV IL10
CMV-inhibiting peptide
CMV pp65
CMV RR1
CMV UL83 protein
c-myb
c-myc

Cn-AMP1
Cn-AMP2
cnc-2
CNCKAPETALCARRCQQHamide
CNDF
cNELL-2
cNeoblasts
CNF1
CNF2
CNF-Vc1
cNGR
CNGRC
CNGRCGGALLLAIRRRKKK
CNGRCGGKLAKLAKKLAKLAK
CNGRCGK
CNGRCVSGCAGRC
cnidocytes
cNK-cells
CNMa
CNMaR
CNMa receptor
C-nociceptors
CNP
cnp1
cnp-1
CNP2
cnp2
cnp-2
cnp3
cnp-3
cnp4
cnp-4
CNP-22
cnp-22
CNP-29
CNP-53
CNP(117)
CNPase
CNPY2
CNS-1
CNS organoids
CNTN2
CNTNAP1
CNTNAP4
CNTF
CNTF II
CNTFR
CNTFR-alpha
CNTF receptor-alpha
CNYYSNS

Co1 antigen
Co1 peptide
Co2 antigen
Co3 antigen
Co4 antigen
CO17-1A
coa
COA7
Co(a) antigen
co-activating SMAD
CO-Ag
coagulation factor-2
coagulation factor-2 receptor
Coagulation factor II receptor-like 1
coagulation factor III
coagulation factor VII
coagulation factor VIIa
coagulation factor X
coagulation factor XII
coagulation factor XIIa
Coagulative necrosis
coagulocytes
coatomer protein complex alpha subunit
COAT platelets
Coats’ disease
cobalt-stimulated chromaffin granule carboxypeptidase
Cob antigen
Co(b) antigen
Cobblestone area
Cobblestone area-forming cells
Co-beta-glucosidase
CO blood group
Cocaine-and amphetamine-regulated transcript protein
Cocaine-and amphetamine-regulated transcript protein(1-39)
Cocaine-and amphetamine-regulated transcript protein(1-89)
Cocaine-and amphetamine-regulated transcript protein(10-89)
Cocaine-and amphetamine-regulated transcript protein(37-54)
Cocaine-and amphetamine-regulated transcript protein(37-55)
Cocaine-and amphetamine-regulated transcript protein(42-89)
Cocaine-and amphetamine-regulated transcript protein(49-89)
Cocaine-and amphetamine-regulated transcript protein(55-102)
Cocaine-and amphetamine-regulated transcript protein(62-102)
cochaperones
cochlear nucleus stellate cells
cochlear root cells
Cockroach-type allatostatins
Coco
Cocos nucifera antimicrobial peptide 1
Cocos nucifera antimicrobial peptide 2
Co-culture angiogenesis assay
Codesane
codocytes
coelilysins
coelomic cytolytic factor
coelomic cytolytic factor-1
coelomocytes
coepibolin
Co-factor V
Coglucosidase
cohort cell migration
coiled-coil domain containing 132
Coiled-coil-helix-coiled-coil-helix domain-containing protein 5
Coiled-coil Helix Tumor and Metabolism 1
Coiled-coil domain-containing protein 3
Coiled-coil domain-containing protein 23
coiled-coil domain containing 80
coiled-coil domain containing 134
coiled-coil domains
coiled coil myosin-like BCL2-interacting protein
COL2A1
COL4A1
COL4A2
COL4A3
COL4A4
COL4A5
COL4A6
COL4A1(1445-1669)
COL4A2(1486-1712)
COL4A3(1445-1669)
COL4A4(1514-1533)
COL4A4(1524-1543)
COL4A4(1628-1646)
COL4A4(1465-1690)
Col4A5(1461-1685)
COL4A5(1516-1535)
COL4A5(1526-1545)
COL4A5(1532-1550)
COL4A6(1515-1534)
COL4A6(1526-1545)
COL4A6(1629-1647)
COL6
COL6A1
COL6A2
COL6A3
COL6A3 C5 fragment
COL8A1
COL8A2
COL11A3
COL14A1
COL15A1
COL18A1
Colchicine sensitivity
cold auto-inflammatory syndrome 1 homolog
cold-induced auto-inflammatory syndrome
Cold-induced sweating syndrome
Cold-inducible RNA-binding protein
cold-insoluble globulin
cold shock domain protein A
cold shock domain containing A1
cold shock domain containing protein A1
Coleoptericin A
Coleoptericin B
Coleoptericins
Coley's toxin
colibactin
colipase
colipase 86
colipase(18-22)
colivelin
coll-1
coll-2
coll-3
coll-4
coll-5
collagen-1-alpha-1
collagen-2
collagen-2-alpha-1
Collagen-2 C-terminal telopeptide
collagen-3-alpha C-terminal telopeptide
collagen-4
collagen-4-alpha-1
collagen-4-alpha-1 NC1 domain
collagen-4-alpha-2
collagen-4-alpha-2 NC1 domain
collagen-4-alpha-3
collagen-4-alpha-3 NC1 domain
collagen-4-alpha-3 NC1 domain(185-191)
collagen-4-alpha-3 NC1 domain(185-203)
collagen-4-alpha-4
collagen-4-alpha-4 NC1 domain
collagen-4-alpha-5
collagen-4-alpha-6
collagen-4-alpha-2(1461-1685)
collagen-4-alpha-3(1445-1669)
collagen-4-alpha-4(1514-1533)
collagen-4-alpha-4(1524-1543)
collagen-4-alpha-4(1628-1646)
collagen-4-alpha-5(1445-1669)
collagen-4-alpha-5(1461-1685)
collagen-4-alpha-5(1516-1535)
collagen-4-alpha-5(1526-1545)
collagen-4-alpha-5(1532-1550)
collagen-4-alpha-6(1515-1534)
collagen-4-alpha-6(1526-1545)
collagen-4-alpha-6(1629-1647)
collagen-6
collagen-6-alpha-1
collagen-6-alpha-2
collagen-6-alpha-3
collagen-6-alpha-3 C5 fragment
collagen-8
collagen-8-alpha-1
collagen-8-alpha-1 NC1 domain
collagen-8-alpha-2
collagen-8-alpha(580-744)
collagen-11-alpha-3
collagen-14
collagen-14-alpha-1
collagen-15
collagen-15-alpha-1
collagen-18
collagen-18(1455-1464)
collagen-18(1450-1464)
collagen-18-alpha-1
collagen-18-alpha-1 NC1 domain
collagen and calcium binding EGF domains 1
Collagenase
Collagenase-1
Collagenase-2
Collagenase-3
Collagenase-4
Collagenase-5
collagenase activating protein
collagenase inhibitor
collagenase stimulatory factor
collagenase type 4
collagenase type 4A
collagenase type 5
collagen binding 59 kDa protein
collagen binding epidermal growth factor
collagen binding fibroblast growth factor
Collagen-binding protein 2
Collagen C-telopeptides
collagen-derived anti-angiogenic factors
collagen/fibrinogen domain-containing protein 1
collagen/fibrinogen domain-containing protein 2
collagen/fibrinogen domain-containing protein 3
collagen/fibrinogen domain-containing protein 3 p35
collagen of basement membrane alpha-4 chain
collagen of cartilage
collagenous repeat-containing sequence of 26-kDa protein
Collagen potentiated neurite promoting factor
collagen synthesis inhibitory factor
Collagen triple helix repeat containing 1
collagen type 1 C-terminal propeptide
collagen type 1 receptor
collagen type 2
collagen type 2B amino-propeptide
collagen type 2 C-propeptide
Collagen type 4
collagen type 6
collagen type 6 C5 domain
collagen type 6 C5 peptide
collagen type 8
collagen type 14
Collagen type 15
collagen type 18
Collagen type I C-terminal telopeptide
Collagen type II C-terminal telopeptide
Collapsin
Collapsin-1
collapsin-2
collapsin-3
collapsin-4
collapsin-5
COLEC1
COLEC10
COLEC11
COLEC12
Collectin-1
collectin-4
collectin-7
Collectin-10
Collectin-11
collectin-12
Collectin-34
collecting duct A-intercalated cells
collecting duct B-intercalated cells
collecting duct intercalated cells
Collectin K1
Collectin kidney protein 1
Collectin L1
Collectin liver protein 1
collectin LK
collectin placenta 1
collectin receptor
collectin subfamily member 11
collective cell death
collective cell migration
Collier
Colligin 2
colliquative necrosis
colloblasts
colloostatin
Colon and small intestine-specific cysteine-rich protein
Colon cancer cell growth inhibitor
colon cancer-initiating cells
Colon cancer secreted protein-1
Colon cancer secreted protein-2
Colon Carcinoma Related Gene
colon-derived SUSD2 binding factor
colonic epithelial cells
Colonic growth factor
colonic HCELL
colonic pericrypt sheath cells
colonocytes
colonoids
colonospheres
Colony formation assay
Colony-forming cells
colony-forming unit blast
colony-forming unit dendritic cell
Colony-forming unit eosinophil
Colony-forming unit eosinophil growth stimulating factor
Colony-forming unit erythroid
Colony-forming unit fibroblast
colony-forming unit fibroblastoid
Colony-forming unit granulocyte
Colony-forming unit granulocyte erythrocyte monocyte macrophage
Colony-forming unit granulocyte inhibitory factor
Colony-forming unit granulocyte macrophage
Colony-forming unit in culture
Colony-forming unit in vitro
Colony-forming unit macrophage
Colony-forming unit megakaryocyte
colony-forming unit reticulo-fibroblastoid
colony-forming units
colony-forming units-Hill
Colony-forming unit spleen
Colony-forming unit spleen stimulating factor
Colony-forming unit stimulating activity
Colony-forming unit stimulating factor
colony-forming unit T
colony-forming unit-LT
colony-forming unit-TL
colony-forming unit T-lymphocyte
colony-forming unit total
Colony-forming unit-tumor
colony-inhibiting lymphokine
Colony inhibitory factor
Colony promoting activity
Colony promoting factor
Colony stimulating activity
Colony stimulating factor-1
Colony stimulating factor-1 binding factor
Colony stimulating factor-2
Colony stimulating factor-2-alpha
Colony stimulating factor-2-beta
Colony stimulating factor-2-gamma
Colony stimulating factor-2 receptor
Colony stimulating factor-2 receptor A
colony stimulating factor-2 receptor-alpha
colony stimulating factor-2 receptor-beta
Colony stimulating factor-3
Colony stimulating factor-4
Colony stimulating factor-309
Colony stimulating factor-alpha
Colony stimulating factor-beta
Colony stimulating factor box
Colony stimulating factors
color-change hormones
colorectal cancer related chromosome sequence 18
colorectal cancer susceptibility 3
colorectal carcinoma growth factor
Colorectal tumor-initiating cells
Colorectum cell-derived growth factor
Colostrinine
Colostrum inhibitory factor
Colton blood group
columnar epithelial cells
Combined oxidative phosphorylation deficiency 6
come-get-me signals
Comet assay
Cometin
command neuron peptide 1
command neuron peptide 2
command neuron peptide 3
command neuron peptide 4
command neuron peptides
command neurons
committed cells
committed stem cells
common acute lymphocytic leukemia antigen
common ALL antigen
common-ALL antigen-positive cells
common beta
common cytokine receptor-beta
common cytokine receptor-gamma
common DC progenitors
common dendritic cell progenitors
common dendritic progenitors
common gamma
common gamma-chain cytokines
common gamma cytokines
common gamma family
common leukocyte antigen
common lymphoid progenitor cells
common monocyte progenitors
common myeloerythroid progenitors
common myeloid progenitors
common myelolymphoid progenitor cells
common myelolymphoid progenitors
common partner SMAD
common pathway SMAD
common progenitor to helper-like innate lymphoid cells
common variable immunodeficiency 3
communal cell death
Communication Biology
COMP-Ang1
Companion layer cells
compass neurons
competence factors
competence genes
Competing endogenous RNAs
Competitive endogenous RNAs
competitive repopulating unit
competitive repopulation assay
complement 3b/4b receptor
complement 3d receptor
complement 5a-like receptor 2
complement 5b-9
complement anaphylatoxin C3a
complement anaphylatoxin C5a
complementary Proteinase-3
complement-associated protein SP-40,40
Complement C1q
Complement C1q-like protein 1
Complement C1q-like protein 2
Complement C1q-like protein 3
Complement C1q-like protein 4
Complement C1q tumor necrosis factor-related protein 1
Complement C1q tumor necrosis factor-related protein 2
Complement C1q tumor necrosis factor-related protein 3
Complement C1q tumor necrosis factor-related protein 4
Complement C1q tumor necrosis factor-related protein 5
Complement C1q tumor necrosis factor-related protein 6
Complement C1q tumor necrosis factor-related protein 7
Complement C1q tumor necrosis factor-related protein 8
Complement C1q tumor necrosis factor-related protein 9
Complement C1q tumor necrosis factor-related protein 9A
Complement C1q tumor necrosis factor-related protein 9B
Complement C1q tumor necrosis factor-related protein 10
Complement C1q tumor necrosis factor-related protein 11
Complement C1q tumor necrosis factor-related protein 12
Complement C1q tumor necrosis factor-related protein 13
Complement C1q tumor necrosis factor-related protein 14
Complement C1q tumor necrosis factor-related protein 15
complement C3
complement C3a
complement C3b
complement C3d receptor 2
Complement C5
complement C5a receptor 1
complement component 1q
complement component 1 q subcomponent A chain
complement component 1 q subcomponent B chain
complement component 1, q subcomponent binding protein
complement component 1 q subcomponent C chain
complement component 1 q subcomponent-like 1
complement component 1 q subcomponent-like 2
complement component 1 q subcomponent-like 3
complement component 1 q subcomponent-like 4
complement component 3d receptor 2
complement component 4A
complement component 4B
complement component 5
complement component 5 receptor 1
complement component 5a receptor 2
complement component C1q
complement component C3
Complement component C3a
Complement component C3b
complement component C4
complement component C4a
complement component C4b
Complement component C4/C5 convertase
complement component C6
Complement component C6(30-48)
complement component D
complement control protein
complement control protein domain
complement decay-accelerating factor
complement factor 6
complement factor B
complement factor Ba
complement factor Bb
complement factor C3
complement factor C3a
Complement factor C3b
complement factor C4
complement factor C5
Complement factor D
Complement factor H
complement factor H-binding protein
complement factor iC3b
complement factor P
complement factor properdin
complement lysis inhibitor
complement properdin P factor
complement receptor-1
complement receptor-2
complement receptor-3
complement receptor-4
complement S protein
complestatin-C6
Complex III subunit 3
Component 15/16
component C
composite cytokine
compound exocytosis
compound granule cells
compound of designation yellow 1
Conantokin-R
c-onc
conditionally immortalized cell lines
conditioned medium
conductin
Cone bipolar cells
cone cells
cone photoreceptor cells
cone photoreceptors
cone rod dystrophy 5
cone-rod dystrophy 12
Conflict of interest declaration
confluent cells
confluent monolayer
congenital dyserythropoietic anemia
Conjunctival goblet cells
conjunctive cells
Connective tissue activating protein-3
connective tissue cells
Connective tissue growth factor
connective tissue growth factor-like
connective tissue macrophages
connective tissue mast cells
connector neurons
connectostatin
Conopressin-G
Conopressin-S
Conopressins
Conopressin-T
conorfamide-Vc1
Conotoxin sleep-inducing peptides
consensus interferon
consensus sequence
Conserved Anti-Apoptotic Protein
conserved dopamine neurotrophic factor
conserved helix-loop-helix ubiquitous kinase
conserved lymphokine element
Constitutive bone marrow adipocytes
constitutive decay elements
constitutive gene expression
constitutive hematopoiesis
constitutively/commonly expressed peptide-like receptor
constitutive serum amyloid A
Contactin-2
Contactin-associated protein
Contactin-associated protein 1
Contactin-associated protein 4
Contactin-associated protein-like 4
Contact information
contactinhibin
Contact inhibition
Contact inhibitory factor
continuous cell lines
Contortrostatin
contra-IL1
Contra-IL2
contraction-band necrosis
conv
conventional dendritic cells
conventional granulocyte/macrophage progenitors
conventional natural killer cells
conventional NK-cells
conventional regulatory T-cells
conventional splenic NK-cells
conventional T-cells
conventional Tregs
conversely underprivileged by difficulties
conversion assays
convertin
convoluted
cooperating SMAD
coordinated cell death
Cop
COP
Cop-1
COP-1
COPA
CopA3
Copaxone
COP cells
COPE
COPEAdopt
COPEAlert
COPE Conflict of Interest Declaration
COPE CONSULTANCY
COPE Contact Information
COPE Mediakit
COPE on Social Networking Sites
Copeptin
COPE Reviews
COPE Scientific Advisory Board
COPE Site Usage Agreement and Disclaimer and Copyright Notice
COPE-VAI
COPE value-added information
COPE version 1.5
COPE version 2.0
COPE version 2.1
COPE version 3.0
COPE version 3.5
COPE version 8.7
COPE version 9.1
COPE version 10.3
COPE version 15.8
COPE version 16.9
COPE version 18.0
COPE version 19.4
COPE version 19.8
COPE version 22.6
COPE version 24.7
COPE version 26.7
COPE version 29.0
COPE version 30.8
COPE version 31.4
COPE version 39.9
COPE version 45.1
COPE version 48.8
COPE version 50.5
COPE version 50.9
COPE version 51.7
COPE version 54.6
COPE version history
copine-7
Copolymer-I
COP-I
copper-accumulating cells
copper cells
Coprisin
Copyright
Corazonin
CORD5
CORD12
cord blood-derived embryonic-like stem cells
cordocytes
COR domain
Core Alpha/Beta-Kenyon cells
co-receptor
corepressor for element-1-silencing transcription factor
CoREST
corifollitropin alfa
CORK1
CoRLs
corn cells
cornea-derived transcript 6
Corneal endothelium modulation factor
Corneal epithelial cell-derived thymocyte activating factor
Corneal epithelial inhibitor of stromal cell collagenase synthesis
corneal fibroblasts
corneal keratan sulfate proteoglycan 37B core protein
corneal mesenchymal-derived cells
corneal stromal cells
corneal stromal fibroblasts
corneal stromal fibrocytes
Cornea micropocket assay
Cornea neovascularization assay
Cornea pocket assay
corneocytes
cornification
cornified envelope formation
coronary smooth muscle cells
coronate amacrine cells
Coronate amacrines
coronate cells
coronavirus 3a protein
Coronavirus 7a protein
Coronavirus envelope protein
Coronavirus E protein
coronavirus NL63 PLP2
coronavirus ORF 3a protein
Coronavirus ORF7a protein
Coronavirus U122 protein
coronavirus U274 protein
coronavirus X1 protein
coronavirus X4 protein
coronet cells
corpus cavernosum smooth muscle cells
Corpus luteum angiogenic factor
Corridor cells
Corridor guidepost neurons
Corridor-like cells
Corridor neurons
CORS26
core-specific lectin
CORT
cortical actin
cortical organoids
cortical thymic epithelial cells
Corticoliberin
corticoliberin neurons
Corticorelin
Corticostatic peptide GP-CS1
Corticostatic peptide GP-CS3
corticostatin HP-4
Corticostatin 1
Corticostatin 2
Corticostatin 3
Corticostatin 4
Corticostatin 6
Corticostatins
corticothyrotropes
corticotrope cells
corticotropes
corticotroph-derived glycoprotein hormone
corticotrophin
corticotrophin releasing factor
corticotrophin releasing hormone
corticotrophs
corticotropic cells
Corticotropin
corticotropin(1-24)
corticotropin-induced secreted protein
Corticotropin-like intermediate peptide
Corticotropin release-inhibiting factor
Corticotropin releasing factor
Corticotropin releasing factor-41
Corticotropin releasing factor(6-33)
Corticotropin Releasing Factor 9-41
Corticotropin releasing factor-binding protein
Corticotropin-releasing factor-like
Corticotropin-releasing factor neurons
Corticotropin releasing factor receptor 1
Corticotropin releasing factor receptor 2
Corticotropin releasing hormone
Corticotropin releasing hormone-41
Corticotropin releasing hormone binding protein
Corticotropin releasing hormone receptor 1
Corticotropin releasing hormone receptor 2
Cortistatin
Cortistatin-14
Cortistatin-17
Cortistatin-29
Cortistatin neurons
cos
COS
cos2
Co-SMAD
CoSMC
COSP-1
costa
costal-2
Costimulator
cOT2
Cotesia plutellae bracovirus BEN
Co-thromboplastin
couch potato
Councilman bodies
Councilman cells
Countertrypin
Coupling of ubiquitin conjugation to ER degradation
COUP-TF-interacting protein 1
cousin of RKIP 1
CoV 3a protein
CoV E protein
COVID-19 virus receptor
CoV S protein
Cowchock syndrome
COWCK
cowpea gamma-thionin 2
Cowpox growth factor
cowpox virus 012 protein
Cowpox Virus 38K gene
cowpox virus 203 protein
Cowpox virus CD30
Cowpox virus CGF
Cowpox virus chemokine binding protein
Cowpox virus crmB
Cowpox virus crmC
Cowpox virus crmD
cowpox virus cytokine response modifier B
cowpox virus cytokine response modifier C
cowpox virus cytokine response modifier D
cowpox virus cytokine response modifier E
cowpox virus K2R protein
Cowpox virus V218 protein
COX-1
COX-2
COX-3
COXPD6
Coxsackie B3 virus 2B protein

Cp
CP1
CP-1
CP2
CP-2
CP4
CP-10
CP10A
CP-11
CP-11C
CP15 peptide
CP17
CP22
CPA
Cpa3Cre/+ mice
Cpa3-Cre; Mcl-1fl/fl mice
CPAF
CPAMD1
CPAMD4
CPAMD5
CPAMD6
CPAN
CPB
CPB-I
CP cells
CPCs
CPDD
Cpdm
CPE
Cpe(fat/fat) mice
CPE-ΔN
C-peptide
C-peptide 1
C-peptide 2
CPF
CPF-1
CPF-3
CPF-4
CPF-5
CPF-6
CPF-7
CPF-AM1
CPF-B1
CPF-C1
CPF-P1
CPF-P2
CPF-P3
CPF peptides
CPF-SE1
CPF-SE2
CPF-SE3
CPF-ST3
CPG15
CPGPEGAGC
CPH
CpIAP
CPI-B
CPIEDRPMC
CPKTRRVPS
cpn10
cpn60
CPNE7
CPNGRC
CPNPF
CPP32
CPP32 MCH2 homolog-1
CPPs
cPR3
CPRF-Ea
CPRF-Eb
CPRF-Ec
CPRK
cPRL
CPRP
CPS
CPS-1
CPS-2
CPS-3
CPS-4
CPS-5
CPS-6
C-PTH
Cp-thionin II
cpto
CPXV012
CPXV203

CQQSNRGDRKRC
CQRPPR

CR1
CR-1
CR2
CR3
CR3a
CR4
CR6
CR8
CR-50 antigen
Cr(a) antigen
crab cells
Crabrolin
CRACC
CRADD
c-raf
c-raf1
CRAF-1
CRAG antigen
CRAL TRIO domain
CRAM
CRAM-A
CRAM antigen
CRAM-B
CRAMP
CRAMP18
craniofacial dysostosis type I
CRASH
Crassostrea gigas Defensin
Crassostrea gigas PGRP
Crassostrea gigas peptidoglycan recognition proteins
Crassostrea gigas proline-rich peptide
CRBP
CRC18
CRCHLRCFCRPRR
CRCP
CRCS3
CRD
CRDGF
CRD-NRG1
cre
CRE
C-reactive protein
C-reactive protein III
C-reactive protein IV
C-reactive protein V
Creative writing
CREB
CREB1
CREB2
CREB3L2
CREB3L2 C-terminal fragment
CREBP1
creeping
CREG
CREG1
CREG2
CREKA peptide
c-Rel
CRELD2
CREM
Cre-Master mice
CREME-9
Cre-mediated mast cell eradication mice
CRE modulator protein
crenated erythrocytes
crenocytes
CRES
Cresp
c-RET
CRF
CRF1
CRF2
CRF2-alpha receptor
CRF2-beta receptor
CRF2 cytokines
CRF2-gamma receptor
CRF2 receptor
CRF2-s1
CRF2 soluble 1
CRF2X
CRF2-4
CRF2-8
CRF2-9
CRF-41
CRF(1-41)
CRF2-10
CRF2-11
CRF2-12
CRF(6-33)
CRF9-41
CRFB4
CRFBP
CRFergic neurons
CRF neurons
CRFR1
CRFR2
CRF receptor 1
CRF receptor 2
CRGs
CRG-1
CRG-2
CRG-3
CRG-4
CRG-5
CRG-6
CRG-7
CRG-8
CRG-9
CRG-10
CRG-11
CRGF
CRGDKGPDC
CRGL2
CRGRRST
CRH
CRH-41
CRH(1-41)
CRH binding protein
CRHBP
CRHergic neurons
CRH neurons
CRHR1
CRHR2
CRH receptor type 1
CRH receptor type 2
CRII-7
CRIF
CRIM1
CRIM2
CRIM3
crinkled
Crinophagy
Criptin
Criptin growth factor
Cripto
Cripto-1
Cripto-1 growth factor
Cripto-3 growth factor
cripto FRL1 cryptic family 1
Cripto growth factor
CRISP3
CRISP9
CRISP-11
CRISPLD2
Crisponi syndrome
CRISPP
Cristin-1
Cristin-2
Cristin-3
Cristin-4
Crk-2
CRKDKC
CRKRLDRN
CRKRLDRNC
CRL1
CRL2
CRL3
CRL4
CRL 1395
CRLF1
CRLF2
CRLF3
CRLM-2
CRLM-3
CRLM9
CRLR
CRLR activity-modifying protein 1
CRLR activity-modifying protein 2
CRLR activity-modifying protein 3
CRLR/RAMP2
CRLR/RAMP3
crmA
crmB
crmC
crmD
crmE
CRNs
CRN-1
CRN-2
CRN-3
CRN-4
CRN-5
CRN-6
CRNF
CRO-AP/2
CRO-AP/3
CRO-AP/5
CROM1
CROM2
CROM3
CROM4
CROM5
CROM6
CROM7
CROM8
CROM9
CROM10
CROM11
CROM12
CROM13
CROM14
CROM15
CROM16
CROM17
CROM18
Cromer blood group antigens
Crooke cells
crooked tail
Croquemort
cross-species specificity
cross-tolerance
crossveinless-2
Crotacetin
Crotalicidin
Crotalicidin(15-34)
Crotamine
crotocetin
Crouzon syndrome
CROV antigen
CROZ antigen
CRP
Crp1
CRP2
Crp4
CRP40
CRP55
CRP(77-82)
CRP(83-90)
CRP(174-185)
CRP(201-206)
CRP-alpha
CRP-beta
Crpd
CRP-ductin
CRP-ductin alpha
CRP-ductin beta
CRP-III
CRP-IV
CRPPR
CRP-V
CRQ
CRRETAWAC
CRS
CRS1C-2
CRS4C-1
CRS4C-1a
CRS4C-1b
CRS4C-1c
CRS4C-2
CRS4C-2a
CRS4C-3
CRS4C-4
CRS57
CRSBP-1
CRS peptides
CRSTRANPC
CRT
CRTAase
CRTAC1
CRTAC1A
CRTAC1B
CRTAM
CRTC
CRTH2
CRU
CRUE antigen
CruFc
Crus-likePm
crusPms2
crusPms3
crusPms4
crustacean cardioactive peptide
Crustacean female sex hormone
Crustacean female sex hormone-1
Crustacean female sex hormone-2
crustacean hematopoietic factor
crustacean hyperglycaemic hormone
crustacean hyperglycaemic hormone A
crustacean hyperglycaemic hormone B
crustacean hyperglycaemic hormone I
crustacean hyperglycaemic hormone II
crustacean hyperglycemic hormone precursor-related peptide
crustacean myosuppressin
crustin Cm1
Crustin I
crustin Ls1
crustin Ls2
crustin Ls3
crustin Lv1
crustin Lv2
crustin Lv3
crustin Lv4
crustin Lv5
crustin Lv6
crustin P
crustinPm1
Crustins
Crust-MS
CRWRWKCCKK
CRYA2
CRYAB
CRYBG1
Cryopyrin
cryopyrin-associated periodic syndrome 1
cryopyrin-associated periodic syndrome 2
cryopyrin-associated periodic syndrome 3
Cryptagastrin
Cryptagastrin-(6-35)
Crypt alpha-Defensins
crypt base columnar cells
Cryptdin-1
Cryptdin-2
Cryptdin-3
Cryptdin-4
Cryptdin-5
Cryptdin-6
Cryptdin-7
Cryptdin-8
Cryptdin-9
Cryptdin-10
Cryptdin-11
Cryptdin-12
Cryptdin-13
Cryptdin-14
Cryptdin-15
Cryptdin-16
Cryptdin-17
Cryptdin-related protein 1C
Cryptdin-related protein 4C-1
Cryptdin-related protein 4C-1a
Cryptdin-related protein 4C-1b
Cryptdin-related protein 4C-1c
Cryptdin-related protein 4C-2
Cryptdin-related protein 4C-4
cryptdin-related sequences
Cryptdins
crypteins
Crypteins Dictionary
Cryptic
Cryptic Antiproliferative Fibronectin Fragment
Cryptic family protein 1
cryptic peptides
Cryptic peptides Dictionary
cryptides
Cryptides Dictionary
crypt neurons
cryptocrine
cryptokines
crypt olfactory neurons
cryptome
Cryptonin
cryptopatch cells
Crystal cells
Crystal induced chemotactic factor
crystallin-alpha-A(70-88)
crystallin-alpha B
crystallin-alpha 2
Crz
C-RZF

CS-1
CS1
CS23
CS5931
CSA
CsA
CS-A
C-SAA
CSAH
CSAID
CSalphabeta defensins
CSAT antigen band 2 protein
CS-B
CSBF
CSC
CSC-21K
CsCCK1
CsCCL17
CsCCL21
CSCKDMSDKECLNFCHQDVIW
CSCKDMTDKECLYFCHQDVIW
CSCNSWLDKECVYFCHLDIIW
CSCSSLMDKECVYFCHLDIIW
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY
CSCSSWLDKECVYFCHLDIIW
CSCUC
CsCXCe1
CSDA
CSDA1
CSDD1
CSDD2
CSD domain
CSE1
CSE1L
CSF
CSF1
CSF1 binding factor
CSF1R
CSF1 receptor
CSF2
CSF2-alpha
CSF2-beta
CSF2-gamma
CSF2R
CSF2RA
CSF2RB
CSF2 receptor
CSF2 receptor-A
CSF2 receptor B
CSF2 receptor-beta
CSF2RY
CSF3
CSF3R
CSF-4
CSF-309
CSF-alpha
CSF-beta
CSF box
CSF-cNs
CSF-contacting neurons
CSF-Eo
CSF-G
CSF-HU
CSF-GM
CSF-M
CSFV p7 protein
CSGMARTKC
CSH1
CSH2
CshFc
CSHL1
CSHL1(83-96)
CSIF
CSIPPEVKFNKPFVYLI
c-sis
CSK
Csk-homologous kinase
CSK peptide
CSKSSDYQC
CsNKL1
CSK-type protein tyrosine kinase
CS-L
CSL
CSL1
CSL2
CSL3
CSLCs
CSLEX1
C-SMAD
CSMC
CSMF
CSN1
CSN1S1
CSN1S2
CSN1S2(182-189)
Csn1s2a
CSN2
CSN3
CSN10
CSN/70
Csng
CSNK
CSP
CSP-1
csp-2
csp-3
CSP3
CSP7
CSP(76-93)
CSP(82-100)
CSP-B
CSP-C
CSPG4
CSPG5
CSPGAK
CSPGAKVRC peptide
Cs-pgrn-1
CSRARKQAASIKVAVSADR
CSRNP1
Csrnp1
Csrnp1a
CSRNP3
CSRPRRSEC
CSSRTMHHC
CST
Cst
CST1
CST2
CST3
CST4
CST5
CST6
CST7
CST8
CST8L
Cst9
Cst10
CST11
CST-14
CST-17
CST-29
CSTA
CSTB
CSTSMLKAC
cSVP

CT
CT-1
CT-2
CT.4S
CT6
CT10 oncogene
CT10-related kinase 2
CT15
CT16
CT31
CT34
CT58
CT71
CT72
CT73
CTA100
CT102
CT16.1
CT80.1
CTACK
cTAGE5
CTAGE family member 5
Ct-AMP1
CTAP-3
CTAP-3 des 1-15
CtBP-interacting BTB zinc finger protein
CTC75
CTCBF
CTC box-binding factor 75 kDa subunit
CTCFTYKDKECVYYCHLDIIW
CTCNDMTDEECLNFCHQDVIW
CTCKDMTDKECLYFCHQDIIW
CTCKDMTDKECLYFCHQGIIW
CT/DH
cTEC
C-telopeptides
ctenidin 1
ctenidin 2
ctenidin 3
Ctenidins
C-terminal flanking peptide
C-terminal glucagon
C-terminal of ROC domain
C-terminal peptide of alpha-1-antitrypsin with a mass of 4.7 kDa
C-terminal peptide of alpha-1-antitrypsin with a mass of 4.8 kDa
C-terminal PTH receptors
CTF
CTF1
CTF2
CTFP
CTGF
CTGF(204-221)
CTGF-L
CTH
CTHRC1
C thyrocytes
CT-ICs
CTIL
CT/IL8
CTIP1
CTK
CTKNSYLMC
CTL
CTL1
CTL1a
CTL1b
CTL44
CTLA-1
CTLA-3
CTLA-4
CTLA-5
CTLA-6
CTLA-7
CTLA-8
CTL differentiation factor
CTLEW
CTLL-2
CTL maturation factor
CTL serine protease-1
CTL serine protease-2
CTL serine protease-3
CTMCs
Ctn
Ctn(15-34)
CTN
C-to-U RNA editing
CTP
ct-proAVP
CTR
CTR1
cTregs
Ctriporin
CTRP1
CTRP2
CTRP3
CTRP4
CTRP5
CTRP6
CTRP7
CTRP8
CTRP9
CTRP9A
CTRP9B
CTRP10
CTRP11
CTRP12
CTRP13
CTRP14
CTRP15
CTRP family
CTS1
CTSGTHPRC
CTSL
CTSL1
CTSS
CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPSYPG
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG
CTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPG
CTVALPGGYVRVC
CTX
CTX-I
CTX-II
C-type allatostatins
C-type carbohydrate recognition domain
C-type lectin 14A
C-type-lectin-60
C-type-lectin-67
C-type-lectin-85
C-type-lectin-87
C-type lectin DDB27
C-type lectin domain family 2 member A
C-type lectin domain family 2 member A1
C-type lectin domain family 2 member B
C-type lectin domain family 2 member C
C-type lectin domain family 2 member D
C-type lectin domain family 2 member G
C-type lectin domain family 2 member I
C-type lectin domain family 4 member A
C-type lectin domain family 4 member C
C-type lectin domain family 4 member D
C-type lectin domain family 4 member E
C-type lectin domain family 4 member J
C-type lectin domain family 4 member K
C-type lectin domain family 4 member L
C-type lectin domain family 4 member M
C-type lectin domain family 4 member N
C-type lectin domain family 5 member B
C-type lectin domain family 5 member C
C-type lectin domain family 6 member A
C-type lectin domain family 7 member A
C-type lectin domain family 9 member A
C-type lectin domain family 10 member A
C-type lectin domain family member 11A
C-type lectin domain family member 11A-alpha
C-type lectin domain family member 11A-beta
C-type lectin domain family 12 member A
C-type lectin domain family 13 member A
C-type lectin domain family 13 member B
C-type lectin domain family 13 member D
C-type lectin domain family 13 member E
C-type lectin domain family 14 member A
C-type lectin domain family 15 member A
C-type lectin domains
C-type lectin domain superfamily member 3
C-type lectin domain superfamily member 3-alpha
C-type lectin domain superfamily member 3-beta
C-type lectin domain superfamily member 6
C-type lectin domain superfamily member 7
C-type lectin domain superfamily member 8
C-type lectin domain superfamily member 9
C-type lectin domain superfamily member 10
C-type lectin domain superfamily member 11
C-type lectin domain superfamily member 12
C-type lectin domain superfamily member 13
C-type lectin domain superfamily member 14
C-type lectin immune receptor
C-type lectin-like domains
C-type lectin-like molecule 1
C-type lectin-like receptor 6
C-type lectin-related molecule-b
C-type lectin-related molecule-g
C-type lectins
C-type natriuretic peptide
C-type natriuretic peptide 1
C-type natriuretic peptide 2
C-type natriuretic peptide 3
C-type natriuretic peptide 4
C-type natriuretic peptide 22
C-type natriuretic peptide 29
C-type natriuretic peptide 53
C-type NP
C-type NP1
C-type NP2
C-type NP3
C-type NP4
C-TyrRS

CUB and EGF-like domain-containing protein 1
CUB domain
CUB domain containing protein 1
Cubitus interruptus
CUB LCCL-homology coagulation factor V/VIII-homology domains protein 1
cuboidal epithelial cells
CUE domain
CUGBP2
CUGBP and ETR3-like factor-2
CUG triplet repeat RNA binding protein 2
CUL4-and DDB1-associated WDR protein 2
culekinin depolarizing peptide I
culekinin depolarizing peptide II
culekinin depolarizing peptide III
culekinin depolarizing peptides
Culex vago
Cultrex
culture-modified mononuclear cells
culture shock
cumulus cell glycodelin
cumulus cells
cumulus granulosa cells
cumulus oophorus cells
cumulus oophorous granulosa cells
cup cells
cupiennin-1a
cupiennin-1b
cupiennin-1c
cupiennin-1d
cupiennins
cuprophilic cells
CUSI
cutaneous dendrocytes
cutaneous lymphocyte-associated antigen
cutaneous small cell undifferentiated carcinoma
cutaneous T-cell attracting chemokine
Cutaneous T-cell lymphoma-associated antigen 5

Cv-2
CVAP
CVARP
CVCPVSNAMCR
cvd
CVID3
CVKTPAQSC
CVN2
CVNHPAFAC
CVS(175-203)
CVSLLRCTGCCGDENLHCVPV

CWMSPRHLGTC

CX3C chemokine receptor 1
CX3C-Chemokines
CX3CL1
CX3C membrane-anchored chemokine
CX3CR1
CXC-46
CXC-56
CXC-64
CXC-66
CXC chemokine ligand 1
CXC chemokine ligand 2
CXC chemokine ligand 3
CXC chemokine ligand 4
CXC chemokine ligand 5
CXC chemokine ligand 6
CXC chemokine ligand 7
CXC chemokine ligand 8
CXC chemokine ligand 9
CXC chemokine ligand 10
CXC chemokine ligand 11
CXC chemokine ligand 12
CXC chemokine ligand 13
CXC chemokine ligand 14
CXC chemokine ligand 15
CXC chemokine ligand 16
CXC chemokine ligand 17
CXC-Chemokine receptor 1
CXC-Chemokine receptor 1-like
CXC-Chemokine receptor 2
CXC-Chemokine receptor 3
CXC-Chemokine receptor 3A
CXC-Chemokine receptor 3B
CXC-Chemokine receptor 4
CXC-Chemokine receptor 5
CXC-Chemokine receptor 6
CXC-Chemokine receptor 7
CXC-Chemokine receptor 8
CXC-Chemokines
CXCd
CXCd1
CXC ELR Chemokines
CX-Chemokines
CXC-Intercrines
CXCL1
CXCL1L
CXCL1L-alpha
CXCL1L-beta
CXCL1-like
CXCL1-like-alpha
CXCL1-like-beta
CXCL2
CXCL2-delta-4
CXCL3
CXCL3L
CXCL3-like
CXCL4
CXCL4L1
CXCL4-induced macrophages
CXCL4L1(47-70)
CXCL4 like-1
CXCL4V1
CXCL4 variant-1
CXCL5
CXCL6
CXCL7
CXCL8
CXCL8 L1
CXCL8 L2
CXCL8 L3
CXCL9
CXCL10
CXCL11
CXCL11 L1
CXCL11 L2
CXCL12
CXCL12a
CXCL12-abundant reticular cells
CXCL12-alpha
CXCL12b
CXCL12-beta
CXCL12-delta
CXCL12-epsilon
CXCL12-expressing mesenchymal progenitor cells
CXCL12-gamma
CXCL12-gamma(68-98)
CXCL12-gamma(77-98)
CXCL12-phi
CXCL12-theta
CXCL13
CXCL14
CXCL14(59-75)
CXCL14-C17
CXCL15
CXCL16
CXCL16v
CXCL17
CXCL9(1-74)
CXCL9(1-75)
CXCL9(1-76)
CXCL9(1-77)
CXCL9(1-78)
CXCL9(1-81)
CXCL9(1-82)
CXCL9(1-84)
CXCL9(1-85)
CXCL8(72-94)
CXCL1(80-103)
CXCL3(80-101)
CXCL5(86-109)
CXCL6(86-109)
CXCL9(74-86)
CXCL9(74-93)
CXCL9(74-103)
CXCL9(79-103)
CXCL9(86-103)
CXCL7(100-121)
CXCL7(50-70)
CXCL9(79-105)
CXCL-F1
CXCL-F2
CXCL-F3
CXCL-F4
CXCL-F5
CXCL-F6
CXCLi1
CXCLi2
CXCR1
CXCR1-like
CXCR2
CXCR3
CXCR3A
CXCR3B
CXCR4
CXCR4A
CXCR4B
CXCR4-Lo
CXCR5
CXCR6
CXCR7
CXCR8
CXC-SIG
CXFLVKEVTKLIDNNKTEKEIL
CXL-chr12a
CXL-chr19a
CXLchr24a
CXL-chr24b
CxVago
CXXXC-Chemokines

CY6
cya
CyA
Cy-AMP1
Cy-AMP2
Cy-AMP3
CYB5R3
CyCAP
Cycas revoluta antimicrobial peptides
cyclase-associated actin cytoskeleton regulatory protein 1
cycle inhibiting factor
cyclic ADP-ribose hydrolase
Cyclic ADP-ribose hydrolase 2
Cyclic AMP responsive element binding protein
Cyclic AMP-responsive element-binding protein 3-like protein 2
cyclic GMP-AMP synthase
cyclic guanosine monophosphate/adenosine monophosphate synthase
cyclic NGR peptide
cyclin D2(139-144)
cycling protein-2
cyclins
Cyclin-dependent kinases
cycloCP-11
cyclo(Cys-Asn-Gly-Arg-Cys)-Gly-Lys
cycloheximide-induced protein-1
cyclomodulins
Cyclooxygenase-1
Cyclooxygenase-2
Cyclooxygenase-3
cyclopeptidic vascular endothelial growth inhibitor
Cyclophilin
cyclophilin-18
Cyclophilin A
Cyclophilin A(22-39)
Cyclophilin A(23-39)
Cyclophilin A(26-39)
Cyclophilin A(63-92)
Cyclophilin A(84-100)
Cyclosporin A binding protein(22-39)
Cyclosporin A binding protein(23-39)
Cyclosporin A binding protein(26-39)
Cyclosporin A binding protein(63-92)
Cyclosporin A binding protein(84-100)
Cyclophilin B
cyclophilin C-associated protein
Cyclophilin-like protein
Cyclophosphamide
cyclo(RIKPHE)
Cyclosporin A
Cyclosporin A binding protein
cyclo-VEGI
CYCRIPACIAGERRYGTCIYQGRLWAFCC
CYCS
Cydia pomonella granulosis virus inhibitor of apoptosis
Cydiastatin-1
Cydiastatin-2
Cydiastatin-3
Cydiastatin-4
Cydiastatin-5
Cydiastatin-6
Cydiastatin-7
cydiastatins
CYFQNCPRG
CYFQNCPRGamide
CYFRA 21-1
CYFRNCPIGamide
CYGB
Cygnin
CYH
CYINNCPVGamide
CYIQNCLRVamide
CYIQNCPLGamide
CYIQNCPRGamide
CYIQSCPIG
CYISNCPIGamide
CYK18
CYLN1
CyLoP-1
CyMMP
Cynoglossus semilaevis CC-Chemokine 1
Cynoglossus semilaevis CC-Chemokine 17
Cynoglossus semilaevis CC-Chemokine 21
Cynoglossus semilaevis CsCXCe1 chemokine
Cynoglossus semilaevis CXC-Chemokine e1
Cynoglossus semilaevis NK-lysin 1
Cynops pyrrhogaster matrix metalloproteinase
CYPA
CYPA(22-39)
CYPA(23-39)
CYPA(26-39)
CYPA(63-92)
CYPA(84-100)
CYPB
CYPH
CYP-S1
CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY
Cyr-61
Cyr-61(234-251)
Cyritestin
Cyritestin 1
Cyritestin 2
CYRL
cyrostatin
Cys-Ala-Arg-Pro-Ala-Arg
Cys-Arg-Cys-His-Leu-Arg-Cys-Phe-Cys-Arg-Pro-Arg-Arg
Cys-Arg-Glu-Lys-Ala
Cys-Arg-Gly-Arg-Arg-Ser-Thr
Cys-Arg-Lys-Asp-Lys-Cys
Cys-Arg-Pro-Pro-Arg
Cys-Asn-Gly-Arg-Cys
Cys-Asn-Gly-Arg-Cys-Gly-Lys
Cys-Asn-Tyr-Tyr-Ser-Asn-Ser
CySCs
CySF
CySF-L1
CySF-L2
CySF-L3
Cys-Gln-Arg-Pro-Pro-Arg
cysknot protein family
Cys-Lys-Ala-Ala-Lys-Asn-Lys
Cys-Lys-Arg-Ala-Val-Arg
Cys-Lys-Arg-Val-Tyr
Cys-Met-Glu-Asn-Ser-Ala
Cys-Pro-Asn-Gly-Arg-Cys
Cys-Ser-Pro-Gly-Ala-Lys
Cys-Ser-Pro-Gly-Ala-Lys-Val-Arg-Cys
Cystatin-1
Cystatin-2
Cystatin-3
Cystatin-4
Cystatin-5
Cystatin-6
Cystatin-7
Cystatin-8
cystatin-9
Cystatin-10
Cystatin-11
Cystatin A
Cystatin B
Cystatin C
Cystatin D
Cystatin E/M
Cystatin F
cystatin-like metastasis-associated protein
cystatin-like molecule
Cystatin M
Cystatin M/E
Cystatin-related epididymal spermatogenic protein
cystatin-related expressed in Sertoli and spermatogonia
Cystatin S
cystatin S(1-14)
cystatin S(61-73)
cystatin S(108-121)
Cystatin SA
Cystatin SA1
Cystatin SA2
Cystatin SA-I
Cystatin SA-III
Cystatin SN
cystatin superfamily
Cysteine array matrix metalloproteinase
Cysteine-Cysteine-Chemokines
Cysteine knot
cysteine knot superfamily
Cysteine protease 32
cysteine proteinase inhibitor B
Cysteine-rich 61
Cysteine-rich angiogenic inducer 61
cysteine-rich BMP regulator-1
cysteine-rich BMP regulator-2
cysteine-rich BMP regulator-3
cysteine-rich domains
cysteine-rich domain associated to RING and TRAF protein
cysteine-rich FGF receptor
cysteine-rich FGF receptor-1
cysteine-rich fibroblast growth factor receptor
cysteine-rich motor neuron protein 1
cysteine-rich neurotrophic factor
cysteine-rich repeat-containing protein S52
Cysteine-rich secreted protein A12-alpha-like 1
cysteine-rich secretory protein-3
cysteine-rich secretory protein 9
Cysteine-rich secretory protein 11
cysteine-rich secretory protein LCCL domain containing 2
cysteine-rich single thrombospondin domain-containing protein-1
cysteine-rich single thrombospondin domain-containing protein-2
cysteine-rich single thrombospondin domain-containing protein-3
cysteine-rich single thrombospondin domain-containing protein-4
cysteine-rich with EGF-like domains 2
Cysteine/serine-rich nuclear protein 1
Cysteine/serine-rich nuclear protein 1a
Cysteine/serine-rich nuclear protein 3
cysteinyl aspartic acid protease-1
cysteinyl aspartic acid protease-2
cysteinyl aspartic acid protease-3
cysteinyl aspartic acid protease-4
cysteinyl aspartic acid protease-5
cysteinyl aspartic acid protease-6
cysteinyl aspartic acid protease-7
cysteinyl aspartic acid protease-8
cysteinyl aspartic acid protease-9
cysteinyl aspartic acid protease-10
cysteinyl aspartic acid protease-11
cysteinyl aspartic acid protease-12
cysteinyl aspartic acid protease-13
cysteinyl aspartic acid protease-14
Cystic fibrosis antigen
Cystic fibrosis antigen A
Cystic fibrosis antigen B
cystic fibrosis transmembrane conductance regulator
Cystine knot
Cystine knot growth factor family
Cystinyl Aminopeptidase
cystoblasts
cystocytes
cyst stem cells
Cys-Tyr-Ile-Asn-Asn-Cys-Pro-Val-Gly
Cys-Tyr-Ile-Gln-Ser-Cys-Pro-Ile-Gly
Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly
CYTB
Cytc
Cyt c(77-101)
Cyt c(86-101)
Cytidine monophospho-N-Acetylneuraminic acid hydroxylase
cytidine to uridine editing
CYTL1
Cyto-c
cytochemokines
cytochrome b
Cytochrome b5 reductase
cytochrome b(345-348)
cytochrome b(345-349)
Cytochrome b-c1 complex subunit 3
Cytochrome C
cytochrome C(70-85)
Cytochrome C(77-101)
Cytochrome C(86-101)
cytochrome C efflux inducing factor
cytochrome cells
Cytochrome c oxidase
Cytochrome-c oxidase chain 7
Cytochrome-c oxidase chain VII
Cytochrome c oxidase subunit 1
Cytochrome c oxidase subunit 2
Cytochrome c oxidase subunit 3
cytochrome C oxidase subunit 8
cytochrophin-4
cytochrophin-5
cytochrophins
cytoglobin
cytokeratin 6
cytokeratin 6A
cytokeratin 6A(533-550)
cytokeratin 6A(533-551)
cytokeratin 6A(534-546)
cytokeratin 6A(534-550)
cytokeratin 6A(534-551)
cytokeratin 6A(537-550)
Cytokeratin-7
cytokeratin-15
Cytokeratin-18
Cytokeratin-18 M30
Cytokeratin-18 M65
Cytokeratin-19
Cytokine 1
Cytokine 11
Cytokine 14
Cytokine 21
Cytokine antagonists
Cytokine-antibody fusion proteins
Cytokine assays
Cytokine C17
Cytokine cascades
Cytokine Concentrations in Biological Fluids
Cytokine CX1
Cytokine-dependent cell lines
cytokine-dependent hemopoietic cell linker
Cytokine expression profiles
Cytokine families
Cytokine flow cytometry
Cytokine fusion toxins
Cytokine gene transfer
Cytokine IK
Cytokine immunotrapping
cytokine-independent survival kinase
cytokine-induced apoptosis inhibitor 1
Cytokine induced killer cells
Cytokine induced neutrophil chemoattractant
Cytokine induced neutrophil chemoattractant-1
Cytokine induced neutrophil chemoattractant-2-alpha
Cytokine induced neutrophil chemoattractant-2-beta
Cytokine induced neutrophil chemoattractant-2-beta-like
Cytokine induced neutrophil chemoattractant-3
Cytokine-Inducible Protein-29
cytokine inducible SH2-containing protein
Cytokine inducible SH2-containing protein-1
Cytokine inducible SH2-containing protein-2
Cytokine inducible SH2-containing protein-3
Cytokine inducible SH2-containing protein-4
Cytokine inducible SH2-containing protein-5
Cytokine inducible SH2-containing protein-6
Cytokine inhibitors
Cytokine Inter-species Reactivities
cytokine-like 1
Cytokine-like factor-1
cytokine-like protein 1
cytokine-like protein family with sequence similarity 3 member A
cytokine-like protein family with sequence similarity 3 member B
cytokine-like protein family with sequence similarity 3 member C
cytokine-like protein family with sequence similarity 3 member D
Cytokine message amplification phenotyping
cytokinemia
Cytokine mimetics
Cytokine network
Cytokine receptor alpha chains
Cytokine receptor beta chains
cytokine receptor common subunit beta
cytokine receptor common subunit gamma
Cytokine receptor families
cytokine receptor family 2 member 4
cytokine receptor family 2 member 8
cytokine receptor family 2 member 9
cytokine receptor family 2 member 10
cytokine receptor family 2 member 11
cytokine receptor family 2 member 12
cytokine receptor family type 1
cytokine receptor family type 2
cytokine receptor family type 2 soluble-1
Cytokine receptor gamma chains
cytokine receptor-like 1
cytokine receptor-like 2
cytokine receptor-like 3
Cytokine receptor-like 4
cytokine receptor-like factor-1
cytokine receptor-like factor-2
cytokine receptor-like factor-3
cytokine receptor-like molecule-2
cytokine receptor-like molecule-3
Cytokine receptor-like molecule 9
cytokine receptor-like protein
Cytokine receptor mimics
Cytokine receptor-related protein 4
Cytokine-related syndrome
Cytokine release syndrome
Cytokine response elements
cytokine response gene 6
cytokine response gene 8
Cytokine response genes
Cytokine response modifier A
Cytokine response modifier B
Cytokine response modifier C
Cytokine response modifier D
Cytokine response modifier E
Cytokine responsive gene-1
Cytokine responsive gene-2
Cytokine responsive gene-3
Cytokine responsive gene-4
Cytokine responsive gene-5
Cytokine responsive gene-6
Cytokine responsive gene-7
Cytokine responsive gene-8
Cytokine responsive gene-9
Cytokine responsive gene-10
Cytokine responsive gene-11
Cytokine responsive genes
cytokines
Cytokines & Cells Online Pathfinder Encyclopaedia
cytokine-specific affinity matrix assay
cytokine spot-forming cells
cytokine storm
cytokine-suppressant anti-inflammatory drug
Cytokine synthesis inhibitory factor
CytokineTopics
cytolethal distending toxins
Cytolipin H
cytolysin
cytolytic differentiation factor for T-lymphocytes
cytolytic differentiation factor
cytolytic factor
cytolytic T-lymphocyte differentiation factor
cytomegalovirus chemokine homolog-1
cytomegalovirus chemokine homolog-2
cytomegalovirus chemokine C motif ligand-1
Cytomegalovirus CXC-Chemokine-2
Cytomegalovirus CXCL2
cytomegalovirus Fc-gamma R2
cytomegalovirus Fc-gamma R3
cytomegalovirus gp68 protein
Cytomegalovirus HJ1
Cytomegalovirus IE1 protein
Cytomegalovirus IE2 protein
Cytomegalovirus IL10
Cytomegalovirus immediate early 72 protein
Cytomegalovirus immediate early 86 protein
Cytomegalovirus-induced gene 5 protein
cytomegalovirus inhibitor of Bak oligomerization
Cytomegalovirus inhibitor of caspase activation
cytomegalovirus inhibitor of RIP1 activation
cytomegalovirus inhibitor of RIP-mediated signaling
cytomegalovirus lymphotactin
Cytomegalovirus M33 protein
cytomegalovirus M36
cytomegalovirus M45
Cytomegalovirus M78 protein
cytomegalovirus m129
cytomegalovirus m131
cytomegalovirus m38.5
cytomegalovirus m41.1
Cytomegalovirus m131/129 protein
cytomegalovirus MCK-1
cytomegalovirus MCK-2
cytomegalovirus mitochondrial inhibitor of apoptosis
Cytomegalovirus orf152 protein
cytomegalovirus OX2 protein
Cytomegalovirus phosphoprotein 71
Cytomegalovirus phosphoprotein pp65
Cytomegalovirus pp65
cytomegalovirus r129 protein
cytomegalovirus r131 protein
cytomegalovirus RR1
Cytomegalovirus UL7 protein
Cytomegalovirus UL16 protein
Cytomegalovirus UL18 protein
Cytomegalovirus UL20A protein
Cytomegalovirus UL22A protein
Cytomegalovirus UL26 protein
Cytomegalovirus UL33 protein
Cytomegalovirus UL36 protein
Cytomegalovirus UL37 protein
Cytomegalovirus UL38 protein
cytomegalovirus UL69 protein
cytomegalovirus UL78
Cytomegalovirus UL82 protein
Cytomegalovirus UL83 protein
Cytomegalovirus UL111a protein
Cytomegalovirus UL122 protein
Cytomegalovirus UL123 protein
Cytomegalovirus UL128 protein
Cytomegalovirus UL138 protein
Cytomegalovirus UL141 protein
Cytomegalovirus UL142 protein
Cytomegalovirus UL144 protein
Cytomegalovirus UL146 protein
Cytomegalovirus UL147 protein
cytomegalovirus UL199-UL118
Cytomegalovirus UL21.5 protein
Cytomegalovirus US2 protein
Cytomegalovirus US3 protein
Cytomegalovirus US6 protein
Cytomegalovirus US11 protein
Cytomegalovirus US18 protein
Cytomegalovirus US27 protein
Cytomegalovirus US28 protein
cytomegalovirus XCL1 protein
cytometric bead array
Cytophagocytosis
Cytoplasmic aconitate hydratase
cytoplasmic activation and proliferation-associated protein 2
cytoplasmic antiproteinase 3
cytoplasmic cell death
cytoplasmic linker-1
cytoplasmic linker protein 170
cytoplasmic NELL-2
cytoplasts
cytoptosis
CYTOR4
cytorrhexis
Cytoskeleton-associated protein 4
cytoskeleton-associated protein 23
cytoskeleton-linking membrane protein 63 kDa
cytosolic aconitase
Cytostatic factor
Cytotactin
Cytotaxin
cytotoxic and regulatory T-cell molecule
Cytotoxic cell-generating factor
cytotoxic cell protease-1
cytotoxic cell protease-2
cytotoxic cell protease-3
Cytotoxic cell protease-4
Cytotoxic cell protease-5
Cytotoxic differentiation factor
Cytotoxic factor
cytotoxic granule-associated RNA-binding protein
cytotoxic granule-associated RNA binding protein-like 1
Cytotoxicity-associated immunodominant antigen
cytotoxicity-dependent APO-1-associated protein 1
cytotoxicity-dependent APO-1-associated protein 2
cytotoxicity-dependent APO-1-associated protein 4
cytotoxicity-dependent APO-1-associated protein 5
cytotoxicity-dependent APO-1-associated protein 6
Cytotoxicity stimulating factor
Cytotoxicity stimulating factor-L1
Cytotoxicity stimulating factor-L2
Cytotoxicity stimulating factor-L3
Cytotoxic killer T-cell activating factor
Cytotoxic lymphocyte maturation factor
Cytotoxic lymphocyte maturation factor-1
Cytotoxic lymphocyte maturation factor-2
Cytotoxic necrotizing factor-1
Cytotoxic necrotizing factor-2
Cytotoxic serine protease-3
cytotoxic serine protease B
cytotoxic serine protease C
Cytotoxic T-cell differentiation factor
cytotoxic T-cells
Cytotoxic T-lymphocyte associated antigen 4
Cytotoxic T-lymphocyte associated antigen 5
Cytotoxic T-lymphocyte associated antigen 6
Cytotoxic T-lymphocyte associated antigen 7
Cytotoxic T-lymphocyte associated antigen 8
Cytotoxic T-lymphocyte associated protein 8
cytotoxic T-lymphocyte-associated serine esterase-1
cytotoxic T-lymphocyte-associated serine esterase 3
cytotoxic T-lymphocyte-associated serine esterase 8
cytotoxic T-lymphocytes
cytotoxic tumor infiltrating lymphocytes
cytotoxin
cytotoxin-associated gene A
cytotrophoblasts



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.