CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG |
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG |
CISH2 |
||
This peptide is a bioactive fragment of Lebestatin.
See also: Angiogenesis Dictionary section of this encyclopedia for other entries directly bearing on factors and processes involved in the generation of new blood vessels.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |