Crotacetin |
Crotalicidin(15-34) |
Rex denuded |
||
abbr. Ctn. This antimicrobial peptide, KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF, from the venom gland of the South American pit viper Crotalus durissus terrificus belongs to the family of snake cathelicidins (so-called vipericidins) and is active against Escherichia coli, Pseudomonas aeruginosa, Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii, and Streptococcus pyogenes.
Falcao et al (2015) have reported that the fragment Ctn(15-34) [Crotalicidin(15-34)] (KKRLKKIFKKPMVIGVTIPF) is more stable in serum, active against Gram-negative bacteria. The peptide also is an
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |