CRF2-11 |
CRF(6-33) |
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
||
[cytokine receptor family 2 member 12] This receptor has been described by Kotenko et al (2003). It has been shown to bind IL28A, IL28B, and IL29. The functional receptor complex consists of this receptor chain and the IL10 receptor-beta chain.
The approved gene symbol for this receptor is IL28RA [interleukin-28 receptor-alpha]. Abbr. also: IL28R-alpha.
The receptor is being referred to also as IL28R1 [interleukin-28 receptor-1], IFN-lambda-R1 [IFN-lambda receptor 1; interferon-lambda receptor-1], IFNLR [interferon-lambda receptor].
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |