Crisponi syndrome |
Cristin-1 |
NOE2 |
||
[cancer recognition, immune defense suppression, and serine protease protection peptide; Cancer-associated SCM-recognition, immunedefense suppression, and serine protease protection peptide] (note: SCM stands for structural changes in mitochondria, which are induced in lymphocytes by the peptide).
CRISPP peptides, described originally by Cercek and Cercek (1992, 1993, 1993) in the blood plasma of patients with different kinds of cancers, are highly homologous (83 % to 100 %) to that of the C-terminal part of alpha-1-antitrypsin, corresponding to region Met358-Gln393) (MSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPT) (for further sequence information see: patent WO1991019736 A2). Therefore, CRISPP would correspond to
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |