COPE Media Kit


Cope Home
Previous entry:
Crisponi syndrome
Next entry:
Cristin-1
Random entry:
NOE2
Search COPE:

CRISPP

[cancer recognition, immune defense suppression, and serine protease protection peptide; Cancer-associated SCM-recognition, immunedefense suppression, and serine protease protection peptide] (note: SCM stands for structural changes in mitochondria, which are induced in lymphocytes by the peptide).

CRISPP peptides, described originally by Cercek and Cercek (1992, 1993, 1993) in the blood plasma of patients with different kinds of cancers, are highly homologous (83 % to 100 %) to that of the C-terminal part of alpha-1-antitrypsin, corresponding to region Met358-Gln393) (MSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPT) (for further sequence information see: patent WO1991019736 A2). Therefore, CRISPP would correspond to ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: December 2016



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=12689