CPXV012 |
CQQSNRGDRKRC |
QVRKYCPKVGYCSSKCSKADVWSLSSDCKFYCCLPPGWK |
||
[cowpox virus 203 protein] This soluble protein encoded in the genome of cowpox virus blocks antigen presentation in both human and murine cells and therefore acts as an immunoevasin, hindering viral clearance by cytotoxic T-cells. CPXV203 prevents MHC 1 proteins from trafficking to the plasma membrane by binding directly to MHC 1 rather than to TAP [transporter associated with antigen processing] (Buyn et al, 2007; McCoy et al, 2012). CPXV203 also downregulates MHC 1 proteins in both murine and human cell lines during normal poxvirus infection (Buyn et al, 2009; Alzhanova et al, 2009).
For another unrelated viral immunoevasin see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |