COPE Media Kit

Cope Home
Previous entry:
CAP6
Next entry:
CAP-18
Random entry:
LAMA3(1411-1422)
Search COPE:

CAP11

[cationic antibacterial polypeptide of 11 kDa] CAP11 (GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI) has been purified from guinea pig neutrophil granules. CAP11 is a disulfide bonded homodimeric protein that is a member of the family of antimicrobial proteins known as cathelicidins. The protein is expressed in bone marrow cells and neutrophils, but not in eosinophils, mononuclear cells, or macrophages. The analysis of bone marrow cells shows that CAP11 mRNA is expressed predominantly at later stages of neutrophil maturation (metamyelocyte stage).

For other proteins/peptides with functions in innate immunity ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: December 2006


 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE   |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R


cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=7546