CgA(116-301) |
CgA(134-225) |
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK |
||
[chromogranin A (124-143)] This fragment of human chromogranin A corresponds to bovine Chromostatin. See: Granins.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |