CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR |
CIIRNCPRGamide |
HEPC |
||
[Caspase-activated DNase inhibitor that interacts with ASK1] This protein has been identified by Cho et al (2003). It acts as an inhibitor of CAD [caspase-activated DNAse] and interacts with ASK1 [apoptosis signal regulating kinase 1], preventing its activation. Overexpressed CIIA reduces cell death by apoptosis mediated by exposure of cells to hydrogen peroxide and TNF-alpha. CIIA antisense oligonucleotides block the inhibitory effect of CIIA on ASK1 activation, DNA fragmentation, and apoptosis.
The protein is identical with VPS28 [Vacuolar protein sorting-associated protein 28 homolog
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |