ChAT development factor |
CHb-2 |
group 3 ILCs |
||
This antimicrobial peptide with the sequence VLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTY has been detected in the acidic extract of blood cells from chicken. The peptide is derived from chicken hemoglobin-alpha, subunit A. The peptide forms pores similar to hemocidins and has been shown to be active in micromolar concentrations against Gram-negative Escherichia coli K12 TG1.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |