CAAP47 |
Ca2+-binding protein from mouse Ehrlich ascites tumour cells |
GXFGPAFHSVSNFAKKHKTA |
||
[C-terminal peptide of alpha-1-antitrypsin with a mass of 4.8 kDa] This peptide with the sequence LEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK corresponds to the C-terminal fragment of the acute phase protein alpha-1-antitrypsin (other terms are: AAT(353-394) or alpha-1-antitrypsin(353-394) or SERPINA1(353-394)) (for a shorter subfragment see also: VIRIP [virus-inhibitory peptide]).
Blaurock et al (2016) have reported that CAAP48 causes cell activation of neutrophils, induces neutrophil chemotaxis, reduces neutrophil viability by inducing
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |