conorfamide-Vc1 |
consensus interferon |
waved-2 |
||
These unrelated peptides that induce sleep-like symptoms in mice have been isolated from the venom of the fish-hunting Conus radiatus. All peptides are characterized by numerous posttranslational modifications, including the presence of several 6-bromotryptophan residues.
Light sleeper peptide (WFGHCTYWLGPCVDDTCCSASCSKFCGLW) has been reported by Jimenez et al (2004). Bromosleeper peptide (WATIDECEETCNVTFKTCCGPPGDWQCVEACPV) has been reported by Craig et al (1997). Conantokin-R (GEEEVAKMAAELARENIAKGCKVNCYP), a selective NMDA antagonist, has been reported by White et al (2000).
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |