CCR4 |
CCR6 |
VQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
[CCR5(+), CCR5(-)]
[CC-Chemokine receptor 5] Old designation: CC-CKR5 (Samson et al, 1996). Also known as CMKBR5. The receptor has been identified independently as CKR5 (Liu et al, 1996). In the nomenclature of CD antigens the receptor has received the designation CD195.
This seven transmembrane-spanning G-protein-coupled receptor (also termed ChemR13, Samson et al, 1996) is expressed in lymphoid organs such as thymus and spleen and on monocytes, macrophages, T-cells, and B-cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |