chromogranin A (116-207) |
chromogranin A (124-143) |
QVLKYCPKIGYCSSKCSKAEVWAYSPDCKVHCCVPANQKW |
||
abbr. CgA(116-301). This fragment of chromogranin A is identical with pancreastatin-186 . See: granins.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |