CBD103 |
CBFGF |
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
||
[collagen binding epidermal growth factor] A fusion protein consisting of a collagen-binding domain derived from Clostridium histolyticum collagenase and EGF fused to the N-terminus of this domain (Nishi et al, 1998). The protein binds tightly to insoluble collagen and stimulates the growth of BALB/c 3T3 fibroblasts as much as the unfused counterparts. When injected subcutaneously into nude mice, CBEGF remains at the sites of injection for up to 10 days, whereas EGF disappears 24 hours after injection. CBEGF does not seem to have a growth-promoting effect in vivo. For a similar protein having growth-promoting effects in vivo see also: CBFGF. For other
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |