CAP4 |
CAP6 |
KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLE |
||
[cytotoxicity-dependent APO-1-associated protein 5] This protein is identical with a functionally active splice variant of Caspase-8 (Caspase-8a). It has been identified as a component of DISC [death-inducing signaling complex] (Medema et al, 1997; Scaffidi et al, 1997).
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |