CD44v8 |
CD44v10 |
ILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
||
[CD44v9(dull), CD44v9(bright)]
This abbreviation refers to a variant form of the CD antigen CD44 that contains the additional alternatively spliced exon 14. Note that all exons of CD44 found in the standard form are also contained in the variant form.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |