Cerebral Peptide 1 |
cerebral perivascular macrophages |
neokyotorphin(1-4) |
||
abbr. CP2. Cerebral Peptide 2 is a peptide of 41 amino acids (FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH) with an amidated carboxyterminus from the sea slug Aplysia californica. It does not appear to be a member of any previously identified peptide family (Phares et al, 1996). Cerebral Peptide 2 is a modulatory neuropeptide synthesized predominantly in the cerebral ganglia and transported to other regions of the central nervous system. Cloning of the cDNA reveals a precursor encoding a single copy of the neuropeptide. The precursor may give rise to additional bioactive neuropeptides, which have been found in neuronal somata and nerves (Vilim et al (2001).
Individual cerebral neurons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |