Ckb8-1 |
Ck-beta-1 |
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
||
[CKII beta-binding protein 1; casein kinase 2-beta binding protein 1] This protein binds to the regulatory beta-subunit of Protein kinase CKII (Casein kinase 2), a kinase required for progression through the cell division cycle (Son et al, 1999). The binding protein is identical with sag [sensitive to apoptosis gene].
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |