COPE Advertising options



Previous Next
Search COPE:
 


- S -

Select one of the following:


s

S1 amacrine cells
S1P1
S1P2
S1P4
S1PR1
S1PR2
S1PR4
S1P receptor 1
S1P receptor 2
S1P receptor 4
S1 protein
S1R protein
S1/S2 amacrine cells

S2 amacrine cells
S2V

S3
S3a

S4X
S4Y

S7
S7 antigen
S7 peptide

S10
S10 cells
S12 antigen
S14G Humanin
S1-5
S17
S19
S19 ribosomal protein

S21
S29

S30

S52
S5.7

S100
S100a
S100a(0)
S100A1
S100A2
S100A3
S100A4
S100A5
S100A6
S100A7
S100A7A
S100A7B
S100A7F
S100A7L1
S100A7L2
S100A8
S100A8/A9
S100A9
S100A10
S100A11
S100A12
S100A13
S100A14
S100A15
S100A16
S100A17
S100A18
S100A12(78-92)
S100-alpha
S100b
S100b(2-11)
S100-beta
S100C
S100C/A11
S100 calcium binding protein A1
S100 calcium binding protein A2
S100 calcium binding protein A3
S100 calcium binding protein A4
S100 calcium binding protein A5
S100 calcium binding protein A6
S100 calcium binding protein A7
S100 calcium binding protein A7A
S100 calcium binding protein A7B
S100 calcium binding protein A7F
S100 calcium binding protein A7-like 1
S100 calcium binding protein A7-like 2
S100 calcium binding protein A8
S100 calcium binding protein A9
S100 calcium binding protein A10
S100 calcium binding protein A11
S100 calcium binding protein A12
S100 calcium binding protein A13
S100 calcium binding protein A14
S100 calcium binding protein A15
S100 calcium binding protein A16
S100 calcium binding protein A17
S100 calcium binding protein A18
S100 calcium binding protein-alpha
S100 calcium binding protein-beta
S100 calcium binding protein C
S100 calcium binding protein D
S100 calcium binding protein E
S100 calcium binding protein F
S100 calcium binding protein G
S100 calcium binding protein L
S100 calcium binding protein P
S100 calcium-binding proteins A8/A9
S100 calcium binding protein Z
S100 calcium binding protein-zeta
S100 Calgranulins
S100D
S100E
S100-E
S100F
S100G
S100L
S100P
S100Z
S100-zeta
S152
S179D PRL
S179D prolactin

S20-3 peptide

SA
SA-7
SA12 peptide
SA-36
SAA
SAA1
SAA1-alpha
SAA1-beta
SAA1-delta
SAA1-gamma
SAA2
SAA3
SAA4
SAA1.1
SAA1.2
SAA1.3
SAA1.4
SAA1.5
SAAG-4
SAA inducer
SAAL
SA-ASC
Sab
Sabia virus Z protein
SABP
Saccharomyces cerevisiae
SACCs
SAC domain
SA cells
SACs
Sad1 and UNC84 domain containing 5
SADVKELIKKWEKQVSQKKKQKNGKKH
SAEFPDFYDSGEHLSPR
SAF
SAF-2
sag
SAG
SAGA-1
SAGATANLPLRS
SAGSCKCKESKSTS
SAHGTSTGVPWP
SAK
Saka
Sal
SALAM
SALAMVY
sALCAM
SALF
salispheres
Salivary acidic protein 1
Salivary agglutinin
Salivary cystatin-L
Salivary cystatin-L2
salivary low molecular mass mucin
Salivary Victory
SALL4
SALL4A
SALL4B
SALL4C
Sal-like-4
SALLRSIPA
SALLRSIPAPAGASRLLLLTGEIDLP
salm
Salmocidin 2A
Salmocidin 2B
Salmocidins
salmon antimicrobial peptide H1
Salmon Antimicrobial Protein
Salmonella invasion protein B
Salmonella invasion protein C
Salmonella invasion protein D
Salmonella typhimurium-derived T-cell inhibitor
Salmonella typhimurium pagN protein
Salp15
Salp15 Iric-1
Salp15 Iric-2
Salp15 Iric-3
Salp15(95-114)
SALPR
salr
SALSDLHAHKLRVDPVNFKLLSH
SALSLGAEQRTESIIHRALYYDLIS
salty taste cells
Salusin-alpha
Salusin-alpha(29gly)
Salusin-beta
Salusins
salvador
salvador homolog 1
Salvic
SAM2
Sam3
SAM and SH3 domain-containing protein 33
SAM domain
SAM domain and HD domain-containing protein 1
samdori
samdori 2
SAMHD1
Samia cynthia ricini PGRP
SA-miRs
SAMP
SAMPs
SAMP H1
san
Sanarelli-Shwartzman phenomenon
SANC
SAN pacemaker cells
sanroque
SANSNPAMAPRERKAGCKNFFWKTFTSC
Sant-7
Santa Claus
SAO
SaOS-2
SAP
SAP-1
SAP1
SAP2
SAP-2
SAPA
SAPB
SAPC
SAPD
SAP domain containing ribonucleoprotein
Sapecin
Sapecin B
Sapecin B-like peptide
Sapecin C
SAPFIECHGRGTCNYYANS
SAPLIP domain
SAPLIPs
Saporin
Saposin A
Saposin B
Saposin C
Saposin D
saposin fold
saposin-like protein family 1
saposin-like protein family 3
saposin-like protein family 5
saposin-like protein family 12
saposin-like proteins
Saposins
sAPP751
sAPP770
sAPP-alpha
SAPQDFVRSamide
SAPRGCWTKSYPPKPCK
SAR2
SARA
Sarafotoxin-a
Sarafotoxin-b
Sarafotoxin-c
Sarafotoxin-d
Sarafotoxin-e
Sarafotoxins
SARAH domain
Sarcolectin
Sarcolectin binding protein
Sarcoma growth factor
sarcospheres
Sarcotoxin-1
Sarcotoxin-1A
Sarcotoxin-1B
Sarcotoxin-1C
Sarcotoxin-2
Sarcotoxin-2A
Sarcotoxin-2B
Sarcotoxin-2C
Sarcotoxin-3
sarcotoxins
Sargramostim
SARI
sarmoptosis
SARNP
SARP
SARP-1
SARP-2
SARP-3
SARS
SARS1
SARS-associated coronavirus 3a protein
SARS-associated coronavirus M protein
SARS-associated coronavirus N protein
SARS-associated coronavirus ORF 3a protein
SARS-associated coronavirus U274 protein
SARS-associated coronavirus X1 protein
SARS coronavirus E protein
SARS coronavirus non-structural protein-1
SARS coronavirus N protein
SARS coronavirus S protein
SARS-CoV-2 receptor
SARS-CoV 3a protein
SARS-CoV E protein
SARS-CoV ORF 3a protein
SARS-CoV Spike glycoprotein
SARS-CoV Spike protein
SARS-CoV-2 Spike protein
SARS-CoV S protein
SAS-1
SASF
Sash3
sash mice
SASP
SATB1
SATB homeobox 1
SA-T cells
satellite cells
satellite glial cells
satellite gliocytes
Satellite microglia
satellite microglial cells
Sauvatide
sav
SAV1
SAVGRHGRRFGLRKHRKH
Sav/Rassf/Hpo domain
SAWGSWS
SAWGSWSKEQLNPQA
SAWRACSVTCGKGIQKRSR
sax
sax3
saxophone

SB-10 antigen
SB-251353
SBACs
SB-cells
SBF
Sbi
SBP
SBP-1
sbRNAs
SBSN

SC-1
SC1
Sc1 antigen
SC2
Sc2 antigen
Sc3 antigen
Sc4 antigen
Sc5 antigen
SC-55494
SCA
Sca-1
SCA-1
Sca-2
SCA-2
SCA27
SCAIF-1
Scallop-AMP
Scallop antimicrobial peptide
scAlu transcripts
SCAMP
SCAMP5
SCAN box
SCAN domain
scaphocephaly with maxillary retrusion and mental
SCAPs
SCAR
SCAR18
SCARA1
SCARA2
SCARA4
Scara5
Scarabaecin
scaramanga
SCARB3
SCARD1
SCARNA19
scaRNAs
SCART
SCART1
SCART2
SCASRCKGHCRARRCGYYVSVLYRGRCYCKCLRC
Scatchard plots
Scatter factor
Scatter factor-like
scatter factor receptor
scavenger cells
scavenger endothelial cells
scavenger receptor A
scavenger receptor AI
scavenger receptor AII
scavenger receptor class A
scavenger receptor class A member 1
scavenger receptor class A member 2
Scavenger receptor class A member 4
scavenger receptor class A member 5
scavenger receptor class B member 3
scavenger receptor class D member 1
scavenger receptor cysteine-rich domains
Scavenger receptor family member expressed on T-cells
Scavenger receptor family member expressed on T-cells 1
Scavenger receptor family member expressed on T-cells 2
Scavenger receptor hlg
scavenger receptor that binds phosphatidylserine and oxidized lipoprotein
scavenger receptor with C-type lectin
scavenger receptors
scb
SC blood group
scc
SCC1
SCC-ETAF
SCCKN
SCC-S2
SCCTF
sCD14
sCD21
sCD23
sCD27
sCD100
sCD137
sCD138
SCDGF
SCDGF-B
SCDO1
SCEIF
s-Cells
S cells
S-cells
SCEPF
scERV1
SCF
SCF-1
SCF-2
SCF165
SCF220
SCF248
SCFR
SCF receptor
SCG1
SCG2
SCG3
SCG4
SCG5
SCG7
SCG2 (344-356)
SCGB1A1
Scgb1d2
SCGB1D4
SCGB2A1
Scgb2a1
SCGB2A2
Scgb2a2
SCGB3A1
SCGB3A2
SCGE
SCGF
SCGF-alpha
SCGFb
SCGF-beta
SCGN
SCGP
Scg-PVK-3
Schistocerca gregaria allatostatins
Schistocerca gregaria myosuppressin
Schistocerca gregaria periviscerokinin-3
schistoFLRFamide
schistocytes
Schistosoma japonicum hsp60(437-460)
Schistostatin-1
Schistostatin-2
Schistostatin-3
Schistostatin-4
Schistostatin-5
Schistostatin-6
Schistostatin-7
Schistostatin-8
Schistostatin-9
Schistostatin-10
schistostatins
Schultze cells
Schwalbe line's cells
Schwangerschaftsprotein 1
Schwann cell growth-inhibitory factor
Schwann cell precursors
Schwann cells
Schwann cell-specific EGF-like repeat autocrine factor
Schwannoma-derived growth factor
Schwann-Remak cells
scw
SCI
Scianna blood group antigen
Sciatic nerve neurotrophic factor
SCID
SCID-Hu mouse
SCID repopulating cells
SCIDX
SCIDX1
Scientific Advisory Board
Scientific writing
SCIF
SCIN
SCIN-B
SCIN-C
SCIRP10-related protein
SCL
SCL1-24
scl-alpha
scl-beta
SCLC surface antigen Cluster-4
scleroblasts
sclerocytes
sclerosteosis
Sclerostin
sclerostin domain-containing protein-1
Sclerostin-like
SCLEYGHSCWGAHamide
sCLU
SCM
SCM-1
SCM-1-alpha
SCM-1-beta
scMPs
SC-MSC
SCMV IL10
Scn
SCN
SCN2
SCNH2
SCNT
scolexin 1
scolexin 2
Scolexin A
Scolexin B
scolexins
Scolopendin
Scolopendin 1
Scolopendin 2
Scolopendrasin III
Scolopendrasin IX
Scolopendrasin V
scolopendrasin VII
Scolopendrasin X
Scolopin-1
Scolopin-2
Scolopins
S-cone cells
S-cones
SCOP
Scorpine
Scorpion defensin
SCO-spondin
SCO-spondin(3652-3670)
Scospondistatin
Scotin
Scots pine antimicrobial peptide-1
Scots pine antimicrobial peptide-2
Scots pine antimicrobial peptide-3
Scots pine antimicrobial peptide-4
Scots pine antimicrobial peptides
SCP
SCP-1
SCP 2
SCP-2
SCP-3
SCPA
SCPB
ScpC
SCPF
SCPs
SCR
scrape-wound assay
Scrapie responsive gene 1
Scratch
scratch-wound assay
Screw
SCRG1
Scr-gallerimycin
SCRIB
Scribble
Scribble1
Scribbled
scrt
SCS-alpha
SCSGF
SCT
SCTE
SCTR
SCUBE1
SCUBE2
SCUBE3
Scurfy
Scvr
Scy1
Scy2
SCYA1
SCYA2
SCYA3
SCYA3L1
SCYA3L2
SCYA3r2
SCYA4
SCYA4L1
SCYA5
SCYA6
SCYA7
SCYA8
SCYA9
SCYA10
SCYA11
SCYA12
SCYA13
SCYA14
SCYA15
SCYA16
SCYA17
SCYA18
SCYA19
SCYA20
SCYA21
SCYA22
SCYA23
SCYA24
SCYA25
SCYA26
SCYA27
SCYA28
SCYB1
SCYB2
SCYB3
SCYB4
SCYB4V1
SCYB4 variant-1
SCYB5
SCYB6
SCYB7
SCYB8
SCYB9
SCYB9B
SCYB10
SCYB11
SCYB12
SCYB13
SCYB14
SCYB15
SCYB16
scyba
SCYC1
SCYC2
S-cyclophilin
SCYD1
SCYE1
SCY family of cytokines
Scygonadin
Scygonadin 1
Scygonadin 2
SCYL1
SCYL2
SCYL3
SCYL4
Scyliorhinin-1
Scyliorhinin-2
Scyliorhinins
Scylla
Scylla paramamosain Anti-lipopolysaccharide factor
Scylla paramamosain Anti-lipopolysaccharide factor 2
Scylla serrata Anti-lipopolysaccharide factor
Scylla serrata antimicrobial protein
Scylla serrata reovirus p35 protein
SCYLP
Scythe

SD-1
SD/01
SDAAVDTSSEITTKDLKEKKEVVEEAEN
SDALAFVPTRamide
SD-BMSC
SDC1
SDC2
SDC3
SDC4
SDCN
SDEDSDGDRPQASPGLGPGP
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
SDF
SDF-1
SDF-1-alpha
SDF-1-beta
SDF-1-delta
SDF-1-epsilon
SDF-1-gamma
SDF-1-phi
SDF-1 receptor
SDF-1-theta
SDF-2
SDF-3
SDF-4
SDF-5
SDF-1(5-67)
SDGF
SDGF-3
SDGF(38-80)
SDIA
SDIP
SDIPNPIGSENSEK
SDKP
SDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA
SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
SDKPNLEEVASFDKTKLKKTETQEKNPLPTKETIEQEKQAS
SDLEGNGVGIGDNHEQALVHPWLYLWGE
SDLHAHKLRVDPVNFKLLSH
SDLTWTYQSPGDPTNSKN
SDMF
SDNFMRFamide
SDNSF
SDPR
SDR
SDR27X1
sdRNAs

se
SE-1
SE-2
Se18.9
Sea-blue histiocytes
SEA domain
SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG
Sea star factor
sebaceous cells
sebaceous epithelial cells
sebaceous gland cells
sebocytes
SEC
SEC14 domain
SEC14 homology domain
SEC16B
Sec16 homolog B
SEC16S
Secapin
Secapin-1
Secapin-2
secondary cell death
secondary cytotoxic T-cell inducing factor
secondary heart field cells
secondary lymphoid organ chemokine
secondary Lymphoid-Tissue Chemokine
secondary necrosis
secondary necrotic cells
secondary oocytes
secondary spermatocytes
secondary trophoblast giant cells
second heart field cells
second mitochondria-derived activator of caspase
second mitochondria-derived activator of caspase-beta
second-order neurons
secPDL1
SECRET
SECRET domain
SECRET domain containing protein 1
SECRET domain containing protein 2
SECRET domain containing protein 3
secretagogin
secretase
secreted and transmembrane 1
secreted and transmembrane 1A
secreted and transmembrane 1B
secreted apoptosis-related protein
secreted apoptosis-related protein-1
secreted apoptosis-related protein-2
secreted apoptosis-related protein-3
secreted apoptosis-related proteins
Secreted cement gland protein XAG-2 homolog
secreted cyclophilin-like protein
secreted EGF repeat and discoidin domains containing protein 1
secreted frizzled-related protein 1
secreted frizzled-related protein 2
secreted frizzled-related protein 3
secreted frizzled-related protein 4
secreted frizzled-related protein 5
secreted frizzled-related proteins
secreted FGF-binding protein
secreted hominoid-specific oncogene
secreted Ly6/PLAUR domain containing 1
secreted Ly6/PLAUR domain-containing protein 2
Secreted Ly6/uPAR-related protein 2
secreted mammalian Ly6/urokinase-type plasminogen activator receptor-related protein 1
secreted microRNAs
secreted modular calcium-binding protein 1
secreted modular calcium-binding protein 2
secreted osteoclastogenic factor of activated T-cells
secreted PDL1
Secreted Phosphoprotein-1
secreted phosphoprotein 2
secreted phosphoprotein-24
secreted protein 18 kDa
secreted protein acidic and rich in cysteine
secreted protein of unknown function
Secretin
Secretin cells
secretin family G-protein-coupled receptors
secretin receptor
secretin receptor-like G-protein-coupled receptors
Secretoglobin 1A1
secretoglobin 1D4
Secretoglobin 2A1
Secretoglobin 2A2
Secretoglobin 3A1
Secretoglobin 3A2
secretoglobin family 1A member 1
Secretoglobin family 1D member 2
secretoglobin family 1D member 4
secretoglobin family 2A member 1
secretoglobin family 2A member 2
secretoglobin family 3A member 1
secretoglobin family 3A member 2
Secretogranin-1
Secretogranin-2
Secretogranin-3
secretogranin-4
secretogranin-5
secretogranin-6
secretogranin-7
secretogranin-2(154-186)
secretogranin-2(182-214)
Secretogranin 2(344-356)
Secretogranin-5(198-210)
secretogranins
Secretolytin
Secretoneurin
secretory actin-binding protein
Secretory carrier membrane protein 5
secretory cells
secretory Clusterin
secretory component p85
Secretory epithelioid cells
secretory granule neuroendocrine protein 1
secretory leukocyte protease inhibitor
secretory leukocyte proteinase inhibitor
secretory pancreatic stone protein
Secretory protein-1
secretory protein in upper respiratory tracts
secretory proteins
SECTM1
SECTM1A
SECTM1B
SED1
seele
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIamide
SEER cells
SEF
Sef-a
Sef-b
Sef-S
segmented cells
segmented granulocytes
segmented neutrophils
SEGN
Sek
Sek1
Sek3
Sek4
SEKYICMNKRGKLIGK
se(l)
Sel1 repeat-containing protein 1
SELE
selectin-E
selectin-L
Selectin-like osteoblast-derived protein
selectin-P
Selectin-P ligand
selective autophagy
SELEKAMVAL
Selel
SELENOP
Selenoprotein P
Selenoprotein P plasma 1
SELEX
Self-acting growth factors
self-associated molecular patterns
self-renewal
self-renewing cells
self-renewing malignant stem cells
self-renewing monocytoid cells
SELL
SEL-OB
SelP
SELP
SELPLG
SELRC1
sem2
Sem-5
SEM1(86-107)
Sem A
SEMA1
SEMA1a
Sema 2
Sema 2a
Sema 2b
SEMA3A
SEMA3B
SEMA3C
SEMA3D
SEMA3E
SEMA3F
SEMA-3G
SEMA4
SEMA4A
SEMA4B
SEMA4C
SEMA4D
SEMA4E
SEMA4F
SEMA4G
SEMA5
SEMA5A
SEMA5B
Sema-5c
SEMA6A
SEMA6A-1
SEMA6B
SEMA6C
SEMA6D
SEMA7A
SEMAA
SEMAB
SEMAC
Semacl1
SEMAD
SEMAE
Semaf
SEMAF
SEMAG
SEMAH
SEMAI
sema III
sema IV
SEMAJ
SEMAK
sema K1
SEMAL
SEMAM
Semaphorin 1
Semaphorin 1a
Semaphorin 1b
Semaphorin 2
Semaphorin 2a
Semaphorin 2b
Semaphorin 3
Semaphorin 3A
Semaphorin 3B
Semaphorin 3C
Semaphorin 3D
Semaphorin 3E
Semaphorin 3F
Semaphorin 3G
Semaphorin 4
Semaphorin 4A
Semaphorin 4B
Semaphorin 4C
Semaphorin 4C receptor
Semaphorin 4D
Semaphorin 4D receptor
Semaphorin 4E
Semaphorin 4F
Semaphorin 4G
Semaphorin 5
Semaphorin 5A
Semaphorin 5A receptor
semaphorin 5A(660-678)
semaphorin 5A(848-866)
Semaphorin 5B
semaphorin 5B(916-934)
Semaphorin 5C
Semaphorin 6A
Semaphorin 6A-1
Semaphorin 6B
Semaphorin 6C
Semaphorin 6D
Semaphorin 7A
Semaphorin A
Semaphorin B
Semaphorin C
Semaphorin D
Semaphorin domain
Semaphorin E
Semaphorin F
Semaphorin G
Semaphorin H
Semaphorin J
Semaphorin K
Semaphorin K1
Semaphorin L
Semaphorin-like protein 139
Semaphorin M
Semaphorin Q
semaphorins
Semaphorin W
Semaphorin Y
Semaphorin Z
Semaphorin Z1a
Semaphorin Z1b
Semaphorin Z2
Semaphorin Z7
SEMAQ
Semastatin-5A.1
Semastatin-5A.2
Semastatin-5B
semaV
sema VIa
Sema VIb
SEMAW
Sema Y
SEMAZ
SemaZ1a
SemaZ1b
SEMA-Z2
Sema-Z7
Sem B
Sem C
Sem D
sem E
semen-derived enhancer of viral infection
Semenogelin
semenogelin-1
Semenogelin-1 (85-113)
semenogelin-1(86-107)
semenogelin-1(108-138)
Semenogelin-2 antimicrobial peptide A
sem F
SEMG
SEMG1
Sem G
semi-embryonic hemoglobins
Seminal alpha-inhibins
seminal exosomes
Seminal plasma factor
seminal plasma glycodelin
seminal plasma inhibitor
seminal plasma sperm motility inhibitor
Seminalplasmin
seminal vesicle protein-4
seminal vesicle secretory protein 4
Seminiferous growth factor
Seminin
Semi-solid
seml
Semliki Forest virus 6K protein
Semliki Forest virus E1 protein
semmelweis
Semper cells
S-endo
S-endo 1
S-endoglin
Sendai virus V protein
Senegalin
senescence
senescence-associated microRNAs
senescence-associated secretory phenotype
senescence-associated T-cells
senescence marker protein-30
Senescent Cell Anti-apoptotic Pathways
Senescent cell antigen
senescent-cell death
senescent cells
senescent microglial cells
Senile Systemic Amyloidosis
SENR
sens
senseless
sensitized cells
sensitive to apoptosis gene
Sensory and motor neuron-derived factor
sensory epithelium neuropeptide-like receptor
sensory neurons
Sensory neuron-specific G-protein coupled receptor 1
Sensory neuron-specific G-protein-coupled receptor 3
Sensory neuron-specific G-protein-coupled receptor 4
sensory organ precursor cells
sentinel cells
Sentrin
Sentrin-1
Sentrin-2
SEP
SeP
SEP4
sepCRP
Sepia Capsule Releasing Peptide
Sepia ink hydrolysate peptide
Sepia ink oligopeptide
Sepiatocin
SePP
SEPP1
Seprase
seprase-l
seprase-s
SEPs
sepsis
SEPT4
septal cells
septin 4
septin H5
septin M
septoclasts
sequence motif
Sequence motifs Dictionary
Sequence tagged site
sequential exocytosis
SER
SER1
SER2
Ser4,Gln8-oxytocin
Ser4,Ile8-oxytocin
Ser5,Ile8-oxytocin
Ser9-orcokinin
SERAF
Ser-Ala-Glu-Phe-Pro-Asp-Phe-Tyr-Asp-Ser-Gly-Glu-His-Leu-Ser-Pro-Arg
Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala
Ser-Arg-Ser-Arg-Tyr
Ser-Arg-Tyr-Pro-Ser-Tyr
Ser-Asn-Gln-Leu-Pro-Gln-Gln
Ser-Asn-Thr-Arg-Val-Ala-Pro
Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn
Seraspenide
Ser-Asp-Glu-Asp-Ser-Asp-Gly-Asp-Arg-Pro-Gln-Ala-Ser-Pro-Gly-Leu-Gly-Pro-Gly-Pro
Ser-Asp-Ile-Pro-Asn-Pro-Ile-Gly-Ser-Glu-Asn-Ser-Glu-Lys
SERF antigen
Ser-Gln-Ala-Phe-Leu-Phe-Gln-Pro-Gln-Arg-Pheamide
Ser-Glu-Ser-Asp-Ser-Ser-Asp-Ser-Asp-Ser-Lys-Ser
Ser-Gly-Ala-Asp-Phe-Tyr-Pro-Trp-Glyamide
Serglycin
Ser-Gly-Gln-Ser-Trp-Arg-Pro-Gln-Gly-Arg-Phe
Ser-Gly-Glu-Leu-Glu-Gln-Glu-Glu-Glu-Arg-Leu-Ser-Lys-Glu-Trp-Glu-Asp-Ser
Sericin
Sericin M
Sericin S
Serine-CCL20
serine esterase-1
serine esterase-2
serine peptidase inhibitor Kunitz type 1
serine peptidase inhibitor Kunitz type 2
serine peptidase inhibitor-like with Kunitz and WAP domains 1
Serine protease 9
serine protease-11
Serine protease 17
Serine protease 18
Serine protease 19
Serine protease 22
serine protease-25
Serine protease 26
serine protease B
Serine protease dependent cell apoptosis
serine protease inhibitor-2
serine protease inhibitor-6
Serine protease inhibitor A3c
Serine protease inhibitor A3n
serine protease inhibitor kazal-type 1
serine protease inhibitor kazal-type 3
serine protease inhibitor kazal-type 4
Serine protease inhibitor Kazal-type 5-like 3
Serine protease inhibitor Kazal-type 13
serine proteinase inhibitor 2
serine proteinase inhibitor A1
serine/threonine kinase 3
serine/threonine kinase 4
serine/threonine kinase receptor 1
serine/threonine protein kinase 17A
serine/threonine protein kinase 17B
Serine/threonine-protein kinase 18
Serine/threonine-protein kinase receptor R3
Serine/threonine-protein kinase receptor R5
Seritocin
SERKAL syndrome
Ser-Leu-Ala-Tyr-Gly-Leu-Arg
Ser-Leu-Thr-Cys-Leu-Val-Lys-Gly-Phe-Tyr
seromucous cells
serophin
Serosal mast cell protease
serotonergic amacrine cells
serotonergic neurons
Serotonin amacrine cells
Serotonin-containing enterochromaffin cells
Serotoninergic amacrine cells
serotoninergic neurons
serotonin neurons
Serotransferrin
serous cells
SERP1
SERP2
SERP3
Ser-Phe-Leu-Leu-Arg-Asn
Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe
Ser-Phe-Phe-Thr-Thr-Val-Asn-Gly-Asn-His-Tyr-Pro-Arg-Ileamide
SERPINA1
SERPINA1(353-372)
SERPINA1(353-394)
SERPINA1(358-393)
SERPINA1(359-394)
SERPINA1(375-418)
SERPINA1(394-428)
Serpin A3c
Serpin A3n
SERPINA4
SERPINA8
SERPINA10
SERPINA12
SERPINA14
SERPINB1
SERPINB2
SERPINB5
SERPINB9
SERPINB10
SERPINB11
SERPINB13
SERPINB14
SERPINB14C
SERPIND1
SERPIND1(39-66)
SERPIND1(49-60)
SERPINE1
SERPINE2
SERPINE2(106-119)
SERPINF1
serpin family A member 1
SERPING1
SERPINH1
Serpinin
serpinin-Arg-Arg-Gly
Serpinin-RRG
serpin peptidase inhibitor clade A member 3c
serpin peptidase inhibitor clade A member 3n
serpin peptidase inhibitor clade A member 4
serpin peptidase inhibitor clade A member 10
serpin peptidase inhibitor clade A member 12
serpin peptidase inhibitor clade A member 14
serpin peptidase inhibitor clade B member 1
serpin peptidase inhibitor clade B member 2
serpin peptidase inhibitor clade B member 5
serpin peptidase inhibitor clade B member 9
serpin peptidase inhibitor clade B member 10
serpin peptidase inhibitor clade B member 11
serpin peptidase inhibitor clade B member 13
serpin peptidase inhibitor clade B member 14
serpin peptidase inhibitor clade B member 14C
serpin peptidase inhibitor clade D member 1
serpin peptidase inhibitor clade E member 1
serpin peptidase inhibitor clade E member 2
serpin peptidase inhibitor clade F member 1
serpin peptidase inhibitor clade G member 1
serpin peptidase inhibitor clade H member 1
Ser-Pro-Ala-Asp-Lys-Thr-Asn-Ile-Lys-Thr-Ala-Trp-Glu-Lys-Ile-Gly-Ser
Ser-Pro-Ala-Phe-Asn-Ser-Trp-Glyamide
Ser-Pro-Ala-Phe-Leu-Phe-Gln-Pro-Gln-Arg-Pheamide
serralysins
Serrate-1
Serrate-2
SerRS
Ser-Ser-Leu-Ser-Lys-Leu
Ser-Ser-Met-Lys-Leu-Ser-Phe-Arg-Ala-Arg-Ala-Tyr-Gly-Phe-Arg-Gly-Pro-Gly-Pro-Gln-Leu
Ser-Ser-Pro-Pro-Lys-Ser-Pro
Ser-Ser-Ser-Lys-Glu-Glu-Asn-Arg-Ile-Ile-Pro-Gly-Gly-Ile
Ser/Thr kinase receptor-2
Ser-Thr-Leu-His-Leu-Val-Leu-Arg-Leu-Arg-Gly-Gly
Sertoli cells
Sertoli cell secreted growth factor
Sertoli cell factor
serum albumin
serum amyloid A
serum amyloid A1
serum amyloid A2
serum amyloid A3
serum amyloid A4
serum amyloid A inducer
serum amyloid P
serum amyloid P component
serum Anti-Apoptosis Factor
Serum aryldialkylphosphatase 2
serum deprivation-induced bone marrow stem cells
serum deprivation protein response
serum deprivation response
serum-derived HA associated protein
serum-derived hyaluronan associated protein
serum factor from patients with ulcerative colitis
serum-free conditioned medium
serum-free medium
Serum/glucocorticoid-regulated kinase 3
serum/glucocorticoid-regulated kinase family member 3
Serum/glucocorticoid-regulated kinase-like
serum lectin p35
Serum paraoxonase/arylesterase 2
Serum PGI2 stabilizing factor
serum protein 90K
serum prothrombin conversion accelerator
serum resistance-associated protein
serum response element
serum response factor
serum response factor accessory protein
serum retinol binding protein
serum spreading factor
serum thymic factor
serum-type mannan-binding protein
serum-type MBP
Ser-Val-Pro-His-Phe-Ser-Glu-Glu-Glu-Lys-Glu-Pro-Glu
Ser-Val-Pro-Leu-Phe-Asn-Phe-Ser-Val-Tyr-Leu-Ala
Ser-Val-Pro-Phe-Lys-Pro-Arg-Leuamide
Ser-Val-Val-Tyr-Gly-Leu-Arg
Seryl-tRNA ligase
Seryl-tRNA synthetase
SERS detection of apoptotic cells
SESDSSDSDSKS
SESN2
Sesquin
SEST2
Sestrin-2
SETA
Setagin
SET domain
severe acute respiratory syndrome coronavirus 3a protein
severe acute respiratory syndrome coronavirus E protein
severe acute respiratory syndrome coronavirus S protein
Severe combined immunodeficiency
severe congenital neutropenia 2
SEVI
SEWSDCSVTCGKGMRTRQR
SEX
sex cells
sex determining region Y box 2
sex determining region Y-box 10
sex determining region Y-box 17
sex determining region Y box 21
sex determining region Y box 25
SEX family
sex hormone-binding globulin
Sex Hormone-dependent tRNA-derived RNAs
Sex muscle abnormal protein 5
sex peptide
sex peptide receptor
Sézary T-cell activating factor
Sez627
Sézary cells

Sf
SF
SF-1
SF2p32
SF20
SF20/IL25
SF65
SF75
SF2000
SF2001
SFA
SFA-1
SF antigen
SfAV-1a ORF121
SfAV1 ORF016
SfAV1 ORF025
SfAV1 ORF074
SfAV1 ORF121
SF-B
SFCs
Sf-caspase-1
SFCM
SFD
SFE
SFFTTVNGNHYPRIamide
SFFV
SFFV gp55
SFGF
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW
SF/HGF
SFHQFARATLAS
SFHQLPARSPLP
SF-HT activated gene 1
SFHVFPPWMCKSLKKC
SfIAP
SFIKPNNVPRV
SFKPSGLPAQSL
SFL
SFLDTLKNLAISAAKGAGQSVLSTLSCKLSKTC
Sf-LLP1
Sf-LLP2
SFLLRN
SFLLRNPNDKYEPF
sFlt-1
sFlk-1
SFM
SFME
SFN
SFPFFPPGICKRLKRC
SFPWMESDVT
sfRamos
SFRNGVGTGMKKTSFQRAKS
sFRP
sFRP1
sFRP2
sFRP3
sFRP4
sFRP5
SFSIIHTPILPL
SFSVNPAVDILQHRYMEKVAQNNRNFLNRVamide
SFTA2
SFTA3
SFTP1
SFTP4
SFTPA1
SFTPA2
SFTPD
SFTPH
sfTSLP
SFUs

SGADFYPWGamide
S-gal
SGALPPAPAAPRPALRAQRAGPAGPGAKamide
SGELEQEEERLSKEWEDS
SGF
SGFVLKGYTKTSQ
SGHQLLLNKMP
SG-I
SGI
SgI-29
s-gicerin
SGIF
SgII
SgIII
SgII peptide A
SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
SgIV
SGIV-IGF
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
SGK3
SGKL
SGLYLGMNEKGELYGS
SGNE1
SGNENGEFYLR
SGP-1
SGP-2
SGP28
sgp-60
SGP-beta
SGP-III
SGP-IV
SGQSWRPQGRFamide
SGRF
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLR
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAG
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPV
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYL
SGRHRFDPFCCEVICDDGTSVKLCT
SGRYLAMNKRGRLYAS
SGSAKVAFSAIRSTNH
SGSVIDQSRVLNLGPI
SgV
SGY
SGY-1
SGYLAFPRMamide

SH2
SH-2
SH2 domain containing leukocyte protein 65 kDa
SH2 domain-containing phosphatase anchor protein-1
SH2 domain-containing phosphatase anchor protein-1A
SH2 domain-containing phosphatase anchor protein-1B
SH2 domain-containing phosphatase anchor protein-1C
SH2 domain-containing phosphatase anchor protein-2
SH2 domain-containing phosphatase anchor protein-2A
SH2 domain-containing phosphatase anchor protein-2B
SH2 domain-containing phosphatase anchor protein-2C
SH2 domain-containing phosphatase anchor protein-2D
SH2 domain-containing phosphatase anchor protein-2E
SH2 domain-containing phosphatase substrate-1
SH2 domain phosphatase
SH3
SH-3
SH3BGRL3
SH3BP1
SH3BP5
SH3 containing Lymphocyte Protein
SH3D1A
SH3 domain binding glutamic acid-rich protein like 3
SH3 domain-binding protein 1
SH3 domain-binding protein 5
SH3 domain-binding protein that preferentially associates with BTK
SH3 domain-containing gene expressed in tumorigenic astrocytes
Sh3 domain-containing protein p17
SH3-domain GRB2-like endophilin B1
SH3 domain kinase binding protein 1
SH3 domain protein 1A
SH3 domain protein expressed in lymphocytes
SH3GLB1
SH3KBP1
SH3P17
SH3 protein expressed in lymphocytes
SH3 protein expressed in lymphocytes 1
SH3 protein interacting with nck 90-kDa
SH-4
SH-9
shadow cells of Gumprecht
SHADOW CHROMO domain
shaft cells
shaker
Shaking Rat Kawasaki
shank-associated RH domain interactor
shank-interacting protein-like 1
SH antigen
SHAP
SHA-peptide
shape-shifted red blood cells
shark cartilage angiogenesis inhibitory factor-1
Sharpin
SHBG
sheath cells
sheathlin
shed 9 kDa B2M
shed 9 kDa Beta-2-Microglobulin
Sheddase
shedding microvesicles
shedding vesicles
Shedding of receptors
SHEDs
sheep erythrocyte receptor
sheep myeloid antimicrobial peptide-29
Sheeppox virus V14 protein
Sheeppox virus SPPV14
sheep red blood cell receptor
sheep reproductive tract antimicrobial peptide-40
shepherd cells
shepherdin
Shepherdin(79-83)
shf
SHF cells
SHH
SH-HSCs
ShIF
shifted
Shiga toxin-producing Escherichia coli
Shigella Cytolethal distending toxin
Shigella invasion plasmid antigens
SHISA5
shisa homolog 5
Shk1 kinase-binding protein 1
SHLP1
SHLP2
SHLP3
SHLP4
SHLP5
SHLP6
SHLPs
shock
SHON
Shope fibroma growth factor
Shope fibroma virus N1R protein
Shope fibroma virus PYD-only protein
Shope fibroma virus PYRIN-only protein
Shope fibroma virus pyrin-only protein 1
Shope growth factor
short axon cells
short-axon neurons
short-chain collagen
short chain dehydrogenase/reductase family 27X member 1
short-chain helical cytokines
short consensus repeats
Short ear
short ear (lethal)
Short gastrulation
short immune suppressor factor
short interfering RNAs
short-lived effector cells
short-lived effector T-cells
short-lived plasma cells
short-MEQ
short neural precursors
short neuropeptide F
short neuropeptide F-1
short neuropeptide F-2
short neuropeptide F-3
short neuropeptide F-4
short neuropeptide F receptor
short neuropeptide F receptor 1
Short NPF
short open reading frames
Short palate lung and nasal epithelium carcinoma-associated protein 1
Short palate lung and nasal epithelium carcinoma-associated protein 2
Short palate lung and nasal epithelium carcinoma-associated protein 3
Short palate lung and nasal epithelium carcinoma-associated protein 5
short peptide from AAT
short piece of alpha-1-antitrypsin
Short PLUNC-1
Short PLUNC-2
Short PLUNC-3
Short PLUNC-5
short resistin
shortsighted
Short-term hematopoietic stem cells
short-term Langerhans cells
short-term LCs
Short-term repopulating cells
short-wave cones
short-wavelength-sensitive cones
SHOT-RNAs
SHP
SHP1
SHPS1
SHP substrate 1
SHPTP1
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ
shRBCs
Shrimp anti-lipopolysaccharide factor
Shrimp ovarian peritrophin
shrinkage necrosis
Shriveled
shRNAs
shs
SHTCEICAYAACAGC
shuchin 1
shuchin 2
shuchin 3
shuchin 4
shuchin 5
shuchins
Shv
Shwartzman phenomenon

sialic acid binding immunoglobulin-like lectin 1
sialic acid binding immunoglobulin-like lectin 2
sialic acid binding immunoglobulin-like lectin 3
sialic acid binding immunoglobulin-like lectin 4
sialic acid binding immunoglobulin-like lectin 4A
sialic acid binding immunoglobulin-like lectin 5
sialic acid binding immunoglobulin-like lectin 6
sialic acid binding immunoglobulin-like lectin 7
sialic acid binding immunoglobulin-like lectin 8
sialic acid binding immunoglobulin-like lectin 9
sialic acid binding immunoglobulin-like lectin 10
sialic acid binding immunoglobulin-like lectin 11
sialic acid binding immunoglobulin-like lectin 12
sialic acid binding immunoglobulin-like lectin 13
sialic acid binding immunoglobulin-like lectin 14
sialic acid binding immunoglobulin-like lectin 15
sialic acid binding immunoglobulin-like lectin 16
sialic acid binding immunoglobulin-like lectin E
sialic acid binding immunoglobulin-like lectin F
sialic acid binding immunoglobulin-like lectin G
sialic acid binding immunoglobulin-like lectin H
sialic acid binding immunoglobulin-like lectins
sialoadhesin
sialoadhesin family member 2
sialocytes
Sialoglycoprotein A
sialoglycoprotein alpha
Sialoglycoprotein B
sialoglycoprotein-beta
Sialoglycoprotein C
Sialoglycoprotein D
Sialoglycoprotein delta
sialokinin I
sialokinin II
sialokinins
sialophorin
sialorphin
Sialostatin L
sialostatin L2
Si-alpha2
sialyl 6-sulfo Lewis X
Sialyl-Lewis X
Sialyl SSEA-1
Sialyl-Tn
Sialyltransferase-1
SIAT1
Sib(a)
SIBLING
SIC
SIC1
Sicca syndrome antigen A
SICD
sickle
sickle cells
SICRI
Side population cells
side population endothelial cells
sideroblasts
Siderocalin
siderocytes
siderophages
Siderophilin
siderotic macrophages
SIDQVEPYSSTAQ
SIDRVEPYSSTAQ
SIDRVEPYSSTAQVQFD
SIF
SIFa
SIF-alpha
SIFamide receptor
SIFamides
SIFaR
SIF-beta
SIF cells
SIGAKILGGVKTFFKGALKELASTYLQ
SIG family of cytokines
SIGH
sightless
SIGIRR
Sigje
SIGLEC-1
SIGLEC-2
SIGLEC-3
SIGLEC-4
SIGLEC-4A
SIGLEC-5
SIGLEC-6
SIGLEC-7
SIGLEC-8
SIGLEC-8L
SIGLEC-8-long
SIGLEC-9
SIGLEC-10
SIGLEC-11
SIGLEC-12
SIGLEC-13
SIGLEC-14
SIGLEC-15
SIGLEC-16
SIGLEC-E
SIGLEC-F
SIGLEC-G
SIGLEC-H
SIGLECL1
SIGLEC-like 1
SIGLEC-like gene
SIGLEC-like gene 2
SIGLECP16
SIGLECs
sigmaC
sigma-Neoblasts
signaling lymphocyte activation molecule
signaling lymphocyte activation molecule family member 1
signaling lymphocyte activation molecule family member 2
signaling lymphocyte activation molecule family member 3
signaling lymphocyte activation molecule family member 4
signaling lymphocyte activation molecule family member 5
signaling lymphocyte activation molecule family member 6
signaling lymphocyte activation molecule family member 7
signaling lymphocyte activation molecule family member 8
signaling molecule that associates with the mouse pelle-like kinase
Signal inhibitory receptor on leukocytes-1
signal peptide
Signal peptide-CUB-EGF-like domain containing protein 1
Signal peptide-CUB-EGF-like domain containing protein 2
Signal peptide-CUB-EGF-like domain containing protein 3
Signalphagy
signal regulatory protein-alpha
signal regulatory protein-alpha-1
signal regulatory protein-alpha-2
signal regulatory protein-alpha-3
signal regulatory protein-beta
signal regulatory protein-beta-1
signal regulatory protein-beta-2
signal regulatory protein-gamma
Signal sequence
signal sequence trap-derived clone 4
Signal transducers and activators of transcription
signal transducer and activator of transcription-1
signal transducer and activator of transcription-1-alpha
signal transducer and activator of transcription-1-beta
signal transducer and activator of transcription-2
signal transducer and activator of transcription-3
signal transducer and activator of transcription-3-alpha
signal transducer and activator of transcription-3-beta
signal transducer and activator of transcription-3-delta
signal transducer and activator of transcription-3-gamma
signal transducer and activator of transcription-4
signal transducer and activator of transcription-5
signal transducer and activator of transcription-5a
signal transducer and activator of transcription-5b
signal transducer and activator of transcription-6
signal-transducing adaptor molecule
signal-transducing adaptor molecule-1
signal-transducing adaptor molecule-2
signal transduction and activation of RNA domain
signal transduction chain
signature
signet cells
signet ring cells
Signiferin 3.1
SIGNR1
SIGNR2
SIGNR3
SIGNR4
SIGN-Related gene 1
SIGN-Related gene 2
SIGN-Related gene 3
SIGN-Related gene 4
SIGRRGGYCAGIIKQTCTCYR
SIGSAFKKALPVAKKIGKAALPIAKAALP
SIGSALKKALPVAKKIGKIALPIAKAALP
SIGTAVKKAVPIAKKVGKVAIPIAKAVLSVVGQLVG
SIH
SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
SIITMTKEAKLPQLWKQIACRLYNTC
SIITMTKEAKLPQSWKQIACRLYNTC
SIITMTREAKLPQLWKQIACRLYNTC
SIITTTKEAKLPQLWKQIACRLYNTC
SIKPSAYLPLRFamide
SIKVAV
sIL1ra
silberblick
Silencer factor B
silencer of death domains
silencing long non-coding derived RNAs
silencing RNAs
silent cell death
silent cells
silent chemokine receptors
silent information regulator 2-like 1
silent information regulator 2-like 7
silent information regulator T1
silkworm paralytic peptide
silondRNAs
SILPTIVSFLSKFLamide
Sim-2 cell-permeable peptide
SIMA135
Simian BSC-1 cell growth inhibitor
Simian cytomegalovirus IL10
Simian sarcoma virus sis
Simian varicella virus ORF61
Simian varicella virus ORF63
Simian virus 5 V protein
similar expression to FGF
SIMPL
Simple epithelia
Simple epithelial cells
SIMU
Sindbis virus 6K protein
Sindbis virus TF protein
Singapore grouper iridovirus ORF062R
single-cell gel electrophoresis assay
single cell necrosis
Single C motif-1
Single C motif-1-alpha
Single C motif-1-beta
single-copy abundant mRNA
single immunoglobulin domain-containing IL1R-related protein
single-negative cells
single-negative thymocytes
single-positive cells
single-positive thymocytes
Single-strand DNA-binding protein NF-GMB
single WAP motif protein 1
single WAP motif protein 2
SINK
sinoatrial node pacemaker cells
sinus B-cells
sinus gland peptide III
sinus gland peptide IV
sinus-lining cells of lymph nodes
SIO
SIP
SIP24
SipB
SipC
SipD
SIPL1
SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
SIPS
SIR2-alpha
SIR2L1
SIR2L7
Sir2-like 1
Sir2-like 7
SIRL-1
siRNAs
SIRPA
SIRP-alpha
SIRP-alpha-1
SIRP-alpha-2
SIRP-alpha-3
SIRPB1
SIRPB2
SIRP-beta
SIRP-beta-1
SIRP-beta-2
SIRPG
SIRP-gamma
SIRS
SIRT1
SIRT1 75 kDa fragment
SIRT7
SIR-T8
sirtuin-1
Sirtuin-7
sis
SISa
SIS-alpha
SISb
SIS-beta
sisC
SISd
SIS-delta
SIS family of cytokines
SISe
SIS-epsilon
SISg
SIS-gamma
si/shRNAs
sis-inducible factor
SISP1
sisRNAs
SISS-B
SISS-T
sisterless C
sit
Sitophilus zeamais PGRP
Siva
Siva-1
Siva-2
SIVPIRCRSNRDCRRFCGFRGGRCTYARQCLCGY
SIVPLGLPVPIGPIVVGPR
SIX
Six Microns Under
six-transmembrane protein of prostate 2
six-transmembrane epithelial antigen of prostate 3
Six-transmembrane epithelial antigen of prostate 4

SJGAP
SjHSP60(437-460)
SJMHE1
Sjögren's syndrome antigen A1

SK
Sk
SK-12
SK-29
sk30
sk30/sk89
SK84
sk89
sk89/sk30
ska
SKALP
Skb1
sKDR
SKEKIGKEFKRIVQRIKDFLRNLVPRTES
skeletal-based precursors of cardiomyocytes
Skeletal growth factor
skeletal muscle cells
skeletal muscle satellite cells
skeletal stem cells
ski
skin antimicrobial peptide 1
Skin-derived antileukoproteinase
Skin-derived antimicrobial protein 2
Skin-derived precursors
skin-derived progenitor cells
Skin fibroblast elastase
Skin Gamma-Delta T-cells
skinkine
skinny hedgehog
skin peptide tyrosine tyrosine
skin permeating and cell entering peptide
skin-PYY
skin trNK-cells
SKIP1
SKIP3
Skipjack Hemoglobin beta chain-related Antimicrobial Peptide
skipjack tuna GAPDH-related antimicrobial peptide
SKITHILAKLGKVLAEVamide
SKKLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
skl
SKMc15
SKMYGFGLamide
SK-N-AS
SKPs
SKR1
SKR2
SKR3
SKR5
SKT factor
SKTFNTHPQSTP
SKW6.4
SKW6-Cl4
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
SKWSECSRTCGGGVKFQER
sky

Sl
SL
SL-1
SL-2
SL-3
SL21
Sl(a)
SLAAPQRFamide
S-lac lectin-1
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
slalom
SL-alpha
SLAM
SLAMF1
SLAMF2
SLAMF3
SLAMF4
SLAMF5
SLAMF6
SLAMF7
SLAMF8
SLAMF9
SLAM family 2000
SLAM family 2001
SLAM family member 1
SLAM family member 2
SLAM family member 3
SLAM family member 4
SLAM family member 5
SLAM family member 6
SLAM family member 7
SLAM family member 8
SLAM family member 9
slanDCs
slan dendritic cells
SLAP
SLAPNILSQL
SLATLAKNGQLPTAEPGEDYGDADSGEPSEQ
SLAYDDKSFENVEFTPRLamide
SLAYGLR
slb
SL-beta
SLC
SLC-1
SLC1A1
SLC3A2
SLC4A1
SLC7A5
SLC11A3
SLC22A13
SLC25A4
SLC25A5
SLC25A6
SLC25A38
SLC40A1
SLC42A1
SLC44A1
SL cytokine
SLDE
SLDSLGSFQVHGW
SLEB1
SLECs
S-lectin domain
SLEV1
SLF
SLFSLIKAGAKFLGKNLLKQGACYAACKASKQC
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
SLG
SLG2
SLGL
SLGGVISGAKKVAKVAIPIGKAVLPVVAKLVG
SLGS
SLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQ
SLHTLF
sli
Sliap
slie
SLIGKVamide
SLIGRLamide
SLILKGLASIAKLFamide
SLIPHAINAVSAIAKHFamide
slit
SLIT1
Slit-1
Slit-1-alpha
SLIT2
Slit-2
Slit-2-C
Slit-2-N
SLIT3
Slit-3
slit guidance ligand 1
slit guidance ligand 2
slit guidance ligand 3
slit homolog-1
slit homolog-2
slit homolog-3
SLITL2
slit-like-2
SLKDKVKSMGEKLKQYIQTWKAKF
SLLADTQSGHRW
SL locus
SLLSLIRKLIT
SLMKRPPGFSPFR
SLMKRPPGFSPFRSSRI
Sl moricin
SLNMLRLamide
SLO
slowC
slowly renewing mesenchymal stem cells
slow muscle fibers
slow oxidative muscle fibers
Slp49
SLP65
sl-p49
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
SLPI
S-LPS
SLRN
SLRR1A
SLRR1B
SLRR1C
SLRR2A
SLRR2C
SLRR2D
SLRR2E
SLRR3A
SLRRSSCFGGRMDRIGAQSGLGCNSFRY
SLSFASR
SLSLITMLKISR
SLSMLRLamide
SLSRFLSFLKIVYPPAFamide
SLT
SLTCLVKGFY
SLTKGRASYTMEFLKYDEAPSNVAQAVIEARGK
SLUG
SLUGH
Sluggish cells
sluggish ganglion cells
SLURP1
SLURP2
SLWENFKNAGKQFILNILDKIRCRVAGGCRT
SLX
SLY
SLy1

SM4
SM-20
SmA
Sma and Mad related protein-1
Sma and Mad related protein-2
Sma and Mad related protein-3
Sma and Mad related protein-4
Sma and Mad related protein-5
Sma and Mad related protein-6
Sma and Mad related protein-7
Sma and Mad related protein-8
Sma and Mad related protein-8A
Sma and Mad related protein-8B
Sma and Mad related protein-9
Sma and Mad related proteins
SMAC
SMAC-beta
SMAC-mimetics
SMAD
SMAD1
SMAD2
SMAD3
SMAD4
SMAD5
SMAD6
SMAD7
SMAD8
SMAD8A
SMAD8B
SMAD9
Smad Anchor for Receptor Activation
SMAD-IRF-binding domain
SMAF
SMAG
S-MAG
SMAG-82
small alveolar cells
Small axonless neurons
small basket cells
small Cajal body-associated RNAs
small Cajal body-specific RNA 1
small cardioactive peptide A
small cardioactive peptide B
small cardioactive peptides
small cartilage-derived glycoprotein
small cationic antimicrobial peptides
small cells
small cholangiocytes
Small cord blood-derived stem cells
small cytoplasmic Alu transcripts
small decidual cells
small-field amacrine cells
small gemistocytes
small granule cells
small granule-containing cells
small hairpin RNAs
small hepatocytes
small humanin-like peptide 1
small humanin-like peptide 2
small humanin-like peptide 3
small humanin-like peptide 4
small humanin-like peptide 5
small humanin-like peptide 6
small humanin-like peptides
Smallie
Small inducible cytokine gene family
Small inducible cytokine A1
Small inducible cytokine A2
Small inducible cytokine A3
Small inducible cytokine A3-like-1
Small inducible cytokine A3-like-2
Small inducible cytokine A4
small inducible cytokine A4-like 1
Small inducible cytokine A5
Small inducible cytokine A6
Small inducible cytokine A7
Small inducible cytokine A8
Small inducible cytokine A9
Small inducible cytokine A10
Small inducible cytokine A11
Small inducible cytokine A12
Small inducible cytokine A13
Small inducible cytokine A14
Small inducible cytokine A15
Small inducible cytokine A16
Small inducible cytokine A17
Small inducible cytokine A18
Small inducible cytokine A19
Small inducible cytokine A20
Small inducible cytokine A21
Small inducible cytokine A22
Small inducible cytokine A23
Small inducible cytokine A24
Small inducible cytokine A25
Small inducible cytokine A26
Small inducible cytokine A27
Small inducible cytokine A28
Small inducible cytokine subfamily B member 1
Small inducible cytokine subfamily B member 2
Small inducible cytokine subfamily B member 3
Small inducible cytokine subfamily B member 4
Small inducible cytokine subfamily B member 4 variant 1
Small inducible cytokine subfamily B member 5
Small inducible cytokine subfamily B member 6
Small inducible cytokine subfamily B member 7
Small inducible cytokine subfamily B member 8
Small inducible cytokine subfamily B member 9
Small inducible cytokine subfamily B member 9B
Small inducible cytokine subfamily B member 10
Small inducible cytokine subfamily B member 11
Small inducible cytokine subfamily B member 12
Small inducible cytokine subfamily B member 13
Small inducible cytokine subfamily B member 14
Small inducible cytokine subfamily B member 15
Small inducible cytokine subfamily B member 16
Small inducible cytokine subfamily B member a
Small inducible cytokine subfamily C member 1
Small inducible cytokine subfamily C member 2
Small inducible cytokine subfamily D member 1
Small inducible cytokine subfamily E member 1
small integral membrane protein 20
small integrin-binding ligand N-linked glycoprotein
small intensely fluorescent cells
small interfering RNAs
small iRNAs
small juvenile stem cells
small luteal cells
small ncRNAs
small non-coding RNAs
small non-protein-coding RNAs
Small nuclear RNAs
small nucleolar RNA host genes
Small nucleolar RNAs
smallpox growth factor
smallpox virus-encoded chemokine receptor domain
small Pre-B-cells
small proliferative adipocytes
small protein with inherent killing effect
small proteoglycan 1
small RNAs
Small Secretory Cells
small stem cells
small-type Kenyon cells
small ubiquitin-related modifier-1
small ubiquitin-related modifier-2
small ubiquitin-related modifier-3
small ubiquitin-related modifier-2/3
small unstable apoptotic protein
small vasohibin-binding protein
small vault RNAs
Sm antigen
SMAP-2
SMAP-6
SMAP-8
SMAP-29
S-MBP
SMC
SmC
SMC-CF
SMC-derived migration factor
SM cells
SMCF
SMDF
SmDLP
SMDPFLFQLLQ
SMEF
SMemG
S-MEQ
SMG-A
SMIM20
SMIR
SML-1
SMLSVLKNLGKVGLGFVACKINKQC
SMLSVLKNLGKVGLGLVACKINKQC
SMM-Chemokine
smo
SMOC1
SMOC2
smoker cells
smoothened
smooth lipopolysaccharides
smooth LPS
smooth monostratified cells
smooth monostratified ganglion cells
Smooth muscle activation-specific genes
smooth muscle-associated protein 2
smooth muscle-associated protein 6
smooth muscle-associated protein 8
smooth muscle cell activation-induced gene-82
Smooth muscle cell chemotactic factor
Smooth muscle cell-derived growth factor
Smooth muscle cell-derived migration factor
smooth muscle cells
smooth muscle derived extracellular matrix factor
smooth muscle elastogenic factor
smooth muscle-like cells
smooth pursuit neurons
SMP
SMP30
SM protein
SMRP
SMSIARL
SMSMLRLamide
SMST
SMT3B
SMT3C
SMT3H3
SMT homolog 3
smtla
smtlb
s-MTPN
SMUCKLER
Smudge cells
SMWSGMWRRKLKKLRNALKKKLKGE
S-myotrophin
S-MZ B-cells

Sn
SN
SN2 antigen
Snaclec crotocetin
SN-Agrin
SNAI2
Snail-2
snail family transcriptional repressor 2
snail homolog 2
snake
snake venom hemorrhagins
Snake venom metalloproteases
snake venom metalloproteinases
snake venom VEGF
Snakin-Z
snapalysins
SNAP receptor domain
SNARE domain
sncRNAs
SNEAFDEDVMGYVIKSNKNIPRMamide
Snell-Bagg mouse
S-neurons
SNGYLALPRQ
SNGYRPAYRPAYRPSYRPGK
SNHGs
snk
Snk/Plk-akin kinase
SNO cells
SNORDs
snoRNAs
sNPF
sNPF1
sNPF2
sNPF3
sNPF4
sNPFR
sNPFR1
SNPs
SNQLPQQ
snRNAs
SNSR3
SNSR4
SNTF
SNTRVAP
SNTVTCGQYVTLYCSTSGNYV
SNYVLKGHRDVQR
SNYYLAMNKKGKLYGS

SOB3
SOCS
SOCS1
SOCS2
SOCS3
SOCS4
SOCS5
SOCS6
SOCS7
SOCS box and WB repeats in protein 1
SOCS box domain
socket cells
SOD
SOD1
SODD
sODF/TRANCE
Sodium-dependent glutamate/aspartate transporter 3
sodium/potassium-dependent ATPase beta-3 subunit
Sodium vanadate
SOFA
SOFAT
Soft agar test
soft phenoptosis
Soft-shelled turtle iridovirus CARD protein
sog
Soggy
soggy-1
Sohar-Crisponi syndrome
Soi-PBAN
Solenopsis invicta pheromone biosynthesis-activating neuropeptide
solid tumor-associated gene 1
solitary cells of Meynert
solitary chemosensory cells
soluble aconitase
soluble aconitate hydratase
Soluble cytokine receptors
Soluble immune response suppressor
Soluble immune suppressor of B-cell responses
Soluble immune suppressor of T-cell responses
Soluble inhibitory factor
soluble macrophage-derived anti-HIV factor
soluble mesothelin-related peptide
soluble mesothelin-related protein
soluble N-cadherin
soluble NSF attachment protein receptor domain
soluble RAGE
soluble resistance-related calcium-binding protein
Soluble suppressor factor
Soluble suppressor factor H
soluble tumor haemolytic factor
solute carrier family 1 member 1
solute carrier family 3 member 2
solute carrier family 4 member 1
solute carrier family 7 member 5
Solute carrier family 11 member 3
solute carrier family 22 (organic anion transporter) member 13
solute carrier family 25 member 4
solute carrier family 25 member 5
solute carrier family 25 member 6
solute carrier family 25 member 38
solute carrier family 40 (iron-regulated transporter) member 1
solute carrier family 42 member 1
solute carrier family 44 member 1
Som
Somatic cell nuclear transfer
Somatic cell reprogramming
somatic cells
Somatic cytokine gene transfer
somatic stem cells
somatochrome cells
Somatocrinin
somatogonadotropes
somatolactin
Somatolactin-alpha
Somatolactin-beta
Somatoliberin
somatomammotrophins
somatomammotropins
Somatomedin A
Somatomedin B
Somatomedin C
Somatomedin/insulin-like growth factor-like polypeptides
Somatomedins
Somatorelin
Somatostatin
somatostatin 1
somatostatin 2
somatostatin-14
somatostatin-28
somatostatin-28(1-12)
somatostatin and angiotensin-like peptide receptor
somatostatin cells
somatostatin I
somatostatin II
Somatostatin neurons
somatostatin receptor 1
somatostatin receptor 2
somatostatin receptor 3
somatostatin receptor 4
somatostatin receptor 5
Somatostatin receptor-like protein 1
somatotrope cells
somatotropes
somatotrophic cells
somatotrophs
somatotropic cells
somatotropic hormone
Somatotropin
Somatotropin receptor
Somatotropin release inhibiting factor
somatotropin release inhibiting factor-14
somatotropin release inhibiting factor-28
Somatotropin release inhibiting hormone
Somatotropin releasing factor
Somatotropin releasing hormone
Somatuline
Some personal remarks
somnogenic cytokine growth factors
SOM neurons
Sonic hedgehog
Sonic hedgehog homolog
son of sevenless
son of sevenless 1
son of sevenless 2
SOP
SOP cells
Sorcin
sORF-encoded polypeptides
sORFs
SORL1
SORL1-beta peptide
SORLA
SorLA-1
Sorsby fundus dystrophy
SORT1
sortilin 1
Sortilin-related receptor
Sortilin-related receptor with A-type repeats
Sorting protein-related receptor containing LDLR class A repeats
SOS
SOS1
SOS2
SOST
SOSTDC1
Sostl
SOST-like
sOT2
sour taste cells
Southeast Asia ovalocytosis
Southpaw
SOX2
SOX2OT
SOX2 overlapping transcript
SOX10
SOX17
SOX21
SOX25
SOXN
Soybean 4-kDa peptide
soy-ghretropin
soymetide-4
soymetide-9
soymetide-13
soymetides
Soymorphin-5
Soymorphin-6
Soymorphin-7
soymorphins

SP
SP-1
SP5
SP(1-7)
sp18
SP90 peptide
SP94 peptide
SP5-52
SP2000
SP2024
SP-40,40
SP5001
SP5028
SP5029
SP5030
SP5031
SP5032
SP5033
SP6001
SP6023
SP6024
SP9144
SP9155
SP-A
SP-A1
SP-A2
SPAAT peptide
SPADKTNIKTAWEKIGS
Spätzle
spätzle-2
spätzle-5
Spätzle processing enzyme
SPACE peptide
SPAFLFQPQRFamide
SPAFNSWGamide
SPAG4L
SPAG4-like protein
SPAG11
SPAG11B
Sp-ALF
SP-alpha
spalt
Spalt-Like Transcription Factor 1
spalt major
spalt-related
Sp-AMP
Sp-AMP-1
Sp-AMP-2
Sp-AMP-3
Sp-AMP-4
SPANAQITRKRHKINSFVGLMamide
SPA-neuropeptide FF
SPANPFF
SPAP1
SPAP1A
SPAP1B
SPAP1C
SPAP2
SPAP2A
SPAP2B
SPAP2C
SPAP2D
SPAP2E
SPAR
SPARC
SPARC113-130
SPARCL1
SPARC-like-1
SPARC-related modular calcium-binding protein 1
SPARC-related modular calcium-binding protein 2
Spasmolysin
Spasmolytic polypeptide
Spasmolytic protein
spastic paraplegia 1
spastic paraplegia 13
Spastic paraplegia 61
Spastic paraplegia 64
SPATA3
SPATA4
SPATA17
spatial view cells
Spaw
SPC-40
SPCA
SP cells
SP-D
SPDCA
SP domain
sPDZD2
spe
SPE10
speB
spEC
special AT-rich sequence-binding protein 1
species antigen 7
species specificity
specific granule protein 28
specific macrophage arming factor
speed cells
Sperm Agglutination Antigen-1
sperm antigen 36
sperm associated antigen 4-like
sperm-associated antigen-11
sperm associated antigen 11B
spermatids
spermatocytes
spermatogenesis associated 3
spermatogenesis associated 4
Spermatogenesis-associated protein 3
Spermatogenesis-associated protein 4
spermatogenesis-associated 17
Spermatogenesis-promoting hormone
spermatogenesis related gene 2
spermatogenic cells
spermatogonia
spermatogonial stem cells
spermatozoon
sperm cells
sperm-coating glycoprotein 2
Sperm maturation-related glycoprotein GP-83
sperm membrane glycopeptide
sperm oocyte binding 3
spermotropin
Spexin
spexin-1
spexin-2
spexin-14a
SP factor
SP-G
SPG1
SPG13
SPG61
SPG64
SPGF
SPH
SP-H
Sph12-38
S phase
Spheniscin
Spheniscin-1
Spheniscin-2
sphere forming assay
sphere-forming cells
sphere-forming units
sphere-initiating cells
spheres
Spherical bushy cells
spheroacanthocytes
spherocytes
spheroidal angiogenesis assay
spheroid forming assay
spheroid-forming unit
spheroid-forming Unrestricted somatic stem cells
spheroids
spheroid sprouting assay
Spherule cells
spherulocytes
SpheUSSCs
Sphingolipid activator protein
sphingolipid activator protein 1
sphingolipid activator protein 2
Sphingosine-1-phosphate receptor 1
Sphingosine-1-phosphate receptor 2
Sphingosine-1-phosphate receptor 4
Sphistin
Sphistin(12-38)
Sphodromantis viridis periviscerokinin-2
Sphsp-PVK-2
Sphvi-PVK-2
SPHYDFGL
SPHYNFGLamide
Spi
SPI-2
Spi2
SPI-6
Spi2.2
spiculated erythrocytes
spiculated poikilocytes
Spider cells
spiderweb cells
Spidery type 1 amacrine cells
Spidery type 2 amacrine cells
SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
SPIKE
spIL33
spin
Spinal cord-derived growth factor
Spinal cord-derived growth factor-B
spindle cells
spindle neurons
spindle-shaped N-cadherin(+) CD45(-) osteoblastic cells
Spinigerin
SPINK1
SPINK3
SPINK4
SPINK13
SPINK5L3
SPINLW1
spinner cultures
spinocerebellar ataxia 27
Spinorphin
spinous cells
spinster
spinster homolog 1
spinster homolog 2
Spinster-like protein 1
SPINT1
SPINT2
Spiny neurons
spiny prickle cells
spiral cells
spitz
spitz-2
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
SPKQDFMRFamide
SpKrox1
Spleen colony assay
spleen colony-forming cells
spleen colony-forming units
Spleen-derived growth factor
Spleen-derived growth factor-3
Spleen-derived immunosuppressive peptide
Spleen focus-forming virus
Splenic Adherent Colony-forming Cells
splenic marginal zone B-cells
Splenin
splenocytes
Splenopentin
spliced galactosidase
spliceosomal RNAs
spliceosome RNAs
splicing factor SF2-associated protein
SPLN
SPLUNC-1
SPLUNC-2
SPLUNC-3
SPLUNC-5
SPM domain
SPMI
spn
SPN
Spn43Ac
SP neurons
SPNS1
SPNS2
Spoc cells
Spod-11-tox
Spodoptera frugiperda
Spodoptera frugiperda ascovirus 1a ORF016
Spodoptera frugiperda ascovirus 1a ORF025
Spodoptera frugiperda ascovirus 1a ORF074
Spodoptera frugiperda ascovirus 1a ORF121
Spodoptera frugiperda ascovirus caspase-7-like protein
Spodoptera frugiperda caspase-1
Spodoptera frugiperda inhibitor of apoptosis
Spodoptera frugiperda lysozyme-like protein 1
Spodoptera frugiperda lysozyme-like protein 2
Spodoptera littoralis inhibitor of apoptosis
Spodoptera littoralis nucleopolyhedrovirus p49 protein
Spodoptera littoralis nucleopolyhedrovirus inhibitor of apoptosis
Spodoptera litura growth-blocking peptide
Spodoptera litura moricin
Spodoptericin
SPON1
SPON2
SPON90
Spondin-1
Spondin-2
spondinstatin-1
spondylocostal dysostosis 1
spongioblasts
spongiotrophoblasts
spongiotrophoblast specific protein
spore-like stem cells
spot-forming cells
SPP
spp-1
SPP1
SPP2
spp-3
spp-5
spp-12
spp24
Spp14.5
Spp16.0
Spp18.1
spp24(50-61)
spp24(121-133)
SPPLAGPPDGLDAVDPERLAHFLNQ
SPQLEDEAKE
SPR
Spred-1
Spred-2
sprinter
S protein
S-prothoracicotropic hormone
sprouting angiogenesis
sprouty
sprouty-1
sprouty-1a
sprouty-1b
sprouty-2
sprouty-3
sprouty-4
Sprouty-related EVH1 domain-containing protein 1
Sprouty-related EVH1 domain-containing protein 2
SPRPRHTLRLSL
spry-1
spry-2
spry-3
spry-4
SPRY/B30.2 domains
SPRYD4
SPRY domain
SPRY domain-containing protein 4
SPS-40
SPSEKAGLQPVGRIGRMLKK
SPSNSKCPDGPDCFVGLMamide
S-PTTH
SPTVMFPPQSVL
SPUF protein
Spur cells
spurt
SPV146
SPV003/148
SPWSKCSAACGQTGVQTRTR
SPWSPCSGNCSTGKQQRTR
SPWSPCSTSCGLGVSTRI
SPWSQCSVRCGRGQRSRQVR
SPWSQCTASCGGGVQTR
SPWTKCSATCGGGHYMRTR
spx
SPX
SPX1
SPX2
spx(1-16)
spx(1-22)
SPX(36-49)
SPX(53-70)
SpyCep
SPYGFRHGASVNYDDY
SPYY
SPY3-2
spz
spz2
spz5

SQAFLFQPQRFamide
squamospheres
squamous alveolar cells
Squamous cell carcinoma epidermal cell-derived thymocyte activating factor
squamous epithelial cells
SQA-neuropeptide FF
SQANPFF
SQWSPCSRTCGGGVSFRER

SR-7 peptide
SR13
SR-17 peptide
SR-4987
SRA
SRA-E5
sRAGE
SRA-I
SRA-II
SRA protein
SRARKQAASIKVAVSADR
SRBC receptor
sRBP
SRCs
src2
src homology domains
src homology domain-2
src homology domain-3
Src homology region 2-domain phosphatase
Src homology region 2-domain phosphatase 1
SRCL
src-like adapter protein
SRCR domains
src-suppressed C kinase substrate
SRDLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
SRE
SREB3
SREBP cleavage activity-1
S-Resistin
SRF
SRF accessory protein 1
SRF/SRH
SRG
SRG2
SRGN
SRH
SRHTGPGNGSGSGAGSGNPFRSPSSQQRPLYYDAPIGKPSKTMYA
SRI
SRIF
SRIF14
SRIF28
SRIF cells
SRK rats
SRMCs
SR-MSC
sRNAs
SRP
SR-PSOX
SRPUL
SRPX2
SRPYSFGLamide
SRRARRSPRESGKKRKRKR
SRRARRSPRHLGSG
SRSRY
SRSSRAGLQFPVGRIHRLLKGNYA
SRSSRAGLQFPVGRIHRLLRK
srt
SRTAP-40
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF
SRTXa
SRTXb
SRTXc
SRTXd
SRTXe
SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRWRH
SRY box 2
SRY box 10
SRY box 17
SRY box 21
SRY box 25
SRY-box containing gene 10
SRY-box containing gene 17
SRY-related HMG-box gene 10
SRY-related HMG box gene 21
SRYPSY
SRY-related HMG box gene 2
SRY-related HMG-box gene 17

SS1
SS2
SS-18
SS-56
SSA
SSA1
SSA antigen
SsALF
SS Alpha-1-antitrypsin
SSAP
SS-A/Ro antigen
SS-A/Ro autoantigen
Ss blood group antigen
SSCFGGRIDRIGAQSGLGCNS
SSCFGGRIDRIGAQSGLGCNSFR
SSCs
SSDRSALLKSKLRALLTAPR
SSEA-1
SSEA-1 Expressing Enhanced Reprogramming cells
SSEA-3
SSEA-4
SSeCKS
SSEVAGEGDGDSMGHEDLY
SSF
SSF-H
SSG1
SSGVSLLTSNKDEEQRELLKA
SSI
SSI1
SSI2
SSI3
SSI4
SSII
SSL 1
SSL-25
SSL-29
SSLLEKGLDGAKKAVGGLGKLGKDA
SSLLEKGLDGAKKAVGGLGKLGKDAVEDL
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSV
SSLSKL
SSLVELDLSYNKLKNIP
SSMKLSFRARAYGFRGPGPQL
SS neurons
SSP
SSPFYGHNFVamide
SSPO
SSPPKSP
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRTamide
SsRV p35 protein
SSS
SSSKEENRIIPGGI
SST
sST2
SST4
SST-14
SST-28
SSTR1
SSTR2
SSTR3
SSTR4
SSTR5

ST-1
ST2
ST-2
ST2L
ST2V
ST-3
ST4
ST6
ST15
ST16
ST38
STAB2
stab cells
Stabilin-2
Stable intronic sequence RNAs
Stable prothrombin conversion factor
St(a) blood group antigen
stab neutrophils
Stäbchenzellen
STAG1
Stage 1 hematogones
Stage 1 NK-cells
Stage 2 hematogones
Stage 2 NK-cells
Stage 3 hematogones
Stage 3 NK-cells
Stage 4 NK-cells
Stage 4a NK-cells
Stage 4b NK-cells
Stage 5 NK-cells
stage-specific embryonic antigen-1
stage-specific embryonic antigen-3
stage-specific embryonic antigen-4
STAI4
stalk cells
stalkokines
STAM
STAM-1
STAM-2
STAM binding protein
STAMBP
STAMP2
standard CD44
standard dendritic cells
standard reprogramming factors
stanniocalcin
stanniocalcin 1
stanniocalcin 2
stanniocalcin-related protein
STAP
STAP cells
Staphylocoagulase
staphylococcal complement inhibitor
Staphylococcal complement inhibitor B
Staphylococcal complement inhibitor C
Staphylococcus aureus alpha-toxin
Staphylococcus aureus beta-toxin
Staphylococcus aureus binder of IgG
Staphylococcus aureus chp
Staphylococcus aureus clumping factors
Staphylococcus aureus coa
Staphylococcus aureus delta-toxin
Staphylococcus aureus Ecb
Staphylococcus aureus Efb
Staphylococcus aureus ehp
Staphylococcus aureus Emp
Staphylococcus aureus fib
Staphylococcus aureus flr
Staphylococcus aureus gamma-toxin
Staphylococcus aureus Map
Staphylococcus aureus MHC class II analog protein
Staphylococcus aureus mprF
Staphylococcus aureus Sbi
Staphylococcus aureus scb
Staphylococcus aureus scc
Staphylococcus aureus SCIN-B
Staphylococcus aureus SCIN-C
Staphylococcus aureus scn
Staphylococcus aureus vWbp
staphylolysin
starburst amacrine cells
Starburst amacrines
starburst cells
STARD12
STARD13
STAR domain
starfish myorelaxant peptide
starfish radial nerve factor
Stargardt disease 4
STAR proteins
StAR-related lipid transfer protein 12
START domain
START domain-containing protein 12
START domain-containing protein 13
START-GAP1
START-GAP2
STAT1
STAT1-alpha
STAT1-beta
STAT2
STAT3
STAT3-alpha
STAT3-beta
STAT3-delta
STAT3-gamma
STAT4
STAT5
STAT5a
STAT5b
STAT6
Stat91
STATI2
STAT induced STAT inhibitor-1
STAT induced STAT inhibitor-2
STAT induced STAT inhibitor-3
STAT induced STAT inhibitor-4
Stationary blebs
STAT proteins
Staurosporine
stave cells
stay-away signals
STC
STC1
STC2
STC50
ST-cells
STCP-1
STCRP
STE20-like protein kinase 1
STE20-like protein kinase 2
STE20-related kinase adaptor-beta
steady-state hematopoiesis
stealth cells
STEAP3
STEAP4
STEAP family member 3
STEAP family member 4
stearyl-TP10
stearyl-Transportan 10
STEC
Steel factor
Steerin-1
Steerin-2
Steerin-3
Stefin A
Stefin B
Stella
Stellate cell activation-associated protein
stellate cells
stellate cells of Ito
stellate neurons
stellate reticuloendothelial cells
StemBios cells
stem-bulge RNAs
Stem cell activating factor
stem cell antigen-1
stem cell antigen-2
Stem cell-Derived Neural stem/progenitor cell Supporting Factor
stem cell-derived tyrosine kinase
Stem cell Dictionary
stem cell expansion inhibitory factor
stem cell expansion promoting factor
Stem cell factor
stem cell factor-165
stem cell factor-220
stem cell factor-248
stem cell factor receptor
Stem cell growth factor
Stem cell growth factor-alpha
Stem cell growth factor-beta
Stem cell inhibition factor
Stem cell inhibitor
stem cell leukemia hematopoietic transcription factor
stem cell-like memory T-cells
Stem cell marker Dictionary
stem cell markers
stem cell memory T-cells
stem cell niche
Stem cell proliferation factor
stem cells
Stem cell separation
stem cells from human exfoliated deciduous teeth
stem cells from the apical papilla
Stem cell tyrosine kinase-1
Stemgen
stem Leydig cells
stem-like cells
stem-like T-cells
stemloids
stem-loop destabilizing elements
stemness
stem/progenitor cells
stem/progenitor-like endothelial cells
stenoteles
sterile alpha motif
Sterile alpha motif and HD-domain containing protein 1
sterile inflammation
Sternberg-Reed cells
Steroidogenesis-inducing protein
steroid-sensitive gene-1
STF1
STFA
STFB
STGD4
S-thanatin
sTHF
ST-HSC
STI
STI1
stichochrome cells
STIF
Stiftchenzellen
Stigmurin
STIM
STIM1
STIM2
Stimulated rat T-cell derived inhibitory factor for cellular DNA
stimulated T-cell chemotactic protein
stimulator of interferon genes
stimulus-triggered acquisition of pluripotency
STING
stinging cells
STIP1
STIP1 homology and U-box containing protein 1
STK
STK-1
STK-1 ligand
STK3
STK4
STK17A
STK17B
STK18
STLHLVLRLRGG
STMY1
STMY2
STMY3
Stoca-PVK/CAP2b-1
Stoca-PVK/CAP2b-2
stomatoacanthocytes
stomatocytes
Stomoxyn
STR1
Stra1
STRADB
STRAD-beta
Stratified epithelia
Stratified epithelial cells
Stratifin
Stratum corneum tryptic enzyme
strawberry
streptococcal chemokine protease C
streptococcal inhibitor of complement-mediated lysis
streptococcal pyrogenic exotoxin B
Streptococcus pneumoniae EstA
Streptococcus pneumoniae esterase A
Streptococcus pyogenes cell-envelope protease
Streptolysin O
stress-activated serum factor
stress-associated molecular patterns
stress axis
Stresscopin
stresscopin-related peptide
stress granules
stress granulopoiesis
stress hematopoiesis
Stressin1
Stress-Induced Chondrocytic 1
Stress-induced-phosphoprotein 1
stress-induced premature senescence
stress induced secreted protein 1
stress-inducible protein 1
stress-inducible tumor rejection antigen GP96
Stress monocytopoiesis
stress myelopoiesis
stress platelets
stress proteins
stress response
stress-responsive peptide
stri
STRICA
strigosus
STRL22
STRL33
STRO-1
stromal barrier cells
Stromal cell-derived factor
Stromal cell-derived factor-1
Stromal cell-derived factor-1-alpha
Stromal cell-derived factor-1-beta
Stromal cell-derived factor-1-delta
Stromal cell-derived factor-1-epsilon
Stromal cell-derived factor-1-gamma
Stromal cell-derived factor-1-phi
Stromal cell-derived factor-1-theta
Stromal cell-derived factor-2
Stromal cell-derived factor-3
Stromal cell-derived factor-4
stromal cell derived factor-5
stromal cell-derived inducing activity
Stromal cell lines
Stromal cell protein-1
stromal cells
Stromal interaction molecule 1
Stromal interaction molecule 2
stromal neuroblastoma cells
Stromal osteoclast-forming activity
stromal precursor antigen 1
stromal stem cells
stromal-vascular fraction cells
stroma noncontact cultures
Stromelysin
Stromelysin-1
Stromelysin-2
Stromelysin-3
Strongylocentrotus purpuratus BLIMP1
strongylocin 1
strongylocin 1b
strongylocin 2
strongylocin 2a
strongylocin 2b
strongylocins
STS
Stuart factor
STUB1
Stunted
Stunted A
Stunted B
STVATL
STVLTS
STVLTSKYR
StVOrth-1
StVOrth-2
StVOrth-3
StVOrth-4
STX2
sty
Styelin A
Styelin B
Styelin C
Styelin D
Styelin E
styelins
Stylicins
S-type alpha motoneurons
S-type antitrypsin
S-type lectins
S-type neuroblastoma cells

SUAP
subcellular membranous particles
subcortical cells
subcortical plate (subplate) neurons
Subcortical white matter interstitial cells
subcultivation
subcultures
Subcutaneous Air Sac model
subependymal tanycytes
subepithelial matrix cells
subfatin
Submandibular gland-A
suboesophageal ganglion neuropeptides
Subperineurial glial cells
subplate neurons
Substance immunologically cross-reactive with insulin
Substance K
Substance K receptor
Substance P
substance P (1-7)
Substance P neurons
Substance P receptor
Subtraction cloning
Subtractive hybridization
subtractive immunization M(+)HEp3 associated 135 kDa protein
subtractive library
substrate-adherent neuroblastoma cells
subventricular radial glial cells
subventricular zone type A cells
subventricular zone type B astrocytes
subventricular zone type B-cells
subventricular zone type C cells
Succinate-CoA ligase
Succinyl-CoA synthetase
Succinyl-CoA synthetase-alpha
SUCLA1
SUCLG1
SuFu
sugar-induced cell death
suicidal emperipolesis
suicidal erythrocyte death
Sulfakinin-1
Sulfakinins
sulfated chorionic gonadotropin
sulfated glycoprotein-1
sulfated glycoprotein-2
sulfated hCG
sulfatide/GH1-activator
Sulfation factor
Sulfation factor activity
Sulfhydryl oxidase 1
Sulfhydryl oxidase 2
Sulfoglucuronyl carbohydrate binding protein-1
SUM-52PE
SUMO1
SUMO2
SUMO3
SUMO2/3
SUMO proteins
SUMOylation
Sun
SUN5
SUN domain
SUN domain-containing protein 5
Sup
Super conserved receptor expressed in brain 3
SUPER determinants
Super enhancers
superficial bladder epithelial cells
superficial facet cells
Superficial short-axon cells
Superficial neuromasts
superficial tufted cells
superficial uroepithelial cells
superficial urothelial cells
superficial zone protein
superficial zone proteoglycan
Supergene family
superinducible protein 24 kDa
Superoxide dismutase
Superoxide dismutase-1
Supersog
supporting cells
Suppressed-by-contrast cells
suppressin
Suppressive B-cell factor
Suppressive E receptor
suppressor endothelial cells
suppressor/inducer T-cells
suppressor macrophages
Suppressor of AP-1 Regulated by IFN
Suppressor of Fused
Suppression of Tumorigenicity 2
Suppression of Tumorigenicity 4
suppressor of tumorigenicity-6
Suppressor of tumorigenicity 15
Suppression of Tumorigenicity-16
Suppressor cell inducing factor
Suppressor cell induction factor
Suppressor E receptor factor
Suppressor factors
Suppressor lymphokine
Suppressor of cytokine signaling
Suppressor of cytokine signaling-1
Suppressor of cytokine signaling-2
Suppressor of cytokine signaling-3
Suppressor of cytokine signaling-4
Suppressor of cytokine signaling-5
Suppressor of cytokine signaling-6
Suppressor of cytokine signaling-7
suppressor T-cells
supraadventitial adipose stromal cells
supraadventitial cells
Suprabasin
Supramarginal cells
Suramin
SURF3
Surface Alpha/Beta-Kenyon cells
surface antigen R2
Surface-associated sulfhydryl protein
surface glycoprotein 60
surface mucous cells
surfactant associated 2
surfactant associated 3
Surfactant-associated protein 2
Surfactant-associated protein 3
Surfactant-associated protein G
Surfactant-associated protein H
surfactant-associated protein, pulmonary 1
surfactant-associated protein, pulmonary 4
surfactant protein A
surfactant protein A1
surfactant protein A2
surfactant protein D
Surfactant protein G
Surfactant protein H
Surfactant pulmonary-associated D-binding protein
surfeit 3
survival factors
survival-promoting peptide
survival-related gene
Survivin
survivin-2a
survivin-2-alpha
survivin-2B
Survivin-2B80-88
survivin-3B
survivin-40
survivin-121
survivin-140
Survivin(79-83)
Survivin(79-87)
survivin(96-104)
survivin antagonistic peptide
Survivin antisense transcript
survivin-deltaEx3
susceptibility to colon cancer 1
SUSD2
Sushi1
Sushi3
Sushi123
sushi domain containing 2
sushi domains
Sushi peptides
Sushi repeat-containing protein x-linked 2
Sushi-repeat protein upregulated in leukemia
sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
Suspension cultures
suspension induced apoptosis
sustentacular cells
SUT-1

SV5 V protein
SV40-induced 24P3 protein
SV40 large T antigen
SV40 VP2 protein
SV40 VP3 protein
SV40 VP4 protein
SVAALAAQGLLNAP
SVAGRAQGM
SVBP
sVEGFR1
sVEGFR2
SVEP1
SVF cells
SVHGLGPVVIamide
SVLGTVKDLLIGAGKSAAQSVLTALSCKLSNSC
SVLTPSLSSLGESLESGIS
SV-IV
SVMPs
SVPFKPRLamide
SVPHFSEEEKEPE
SVPLFNFSVYLA
SVQILRCPDGMQMLRSGQCVATTEPPFDPSY
svRNAs
Svs4
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVamide
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
SVSVGMKPSPRP
SVTLSLRLPFPS
SVV
SVVYGLR
svVEGF

SW
Sw
SW-13
Swa
Swain-Langley blood group antigen
SWAM1
SWAM2
Swann antigen
Swann blood group antigen
Swaposin domain
SWASMAKKLKEYMEKLKQRA
SWC2
SWC9
SWDIAWPPLKVP
sweat gland clear cells
sweat gland dark cells
Sweat gland factor
sweet taste cells
swelling necrosis
SWFSRTVHNVGNAVRKGIHAGQGVCSGLGL
swine workshop cluster 2
swine workshop cluster 9
swinepox virus SPV003/148 protein
Swinepox virus SPV146
SWIP1
Swiprosin-1
Swiss 3T3 cells
Swiss-type agammaglobulinemia
Switch factors
Switch cultures
switch phenotype macrophages
SWKSMAKKLKEYMEKLKQRA
SWLSKTAKKLENSAKKRISEGIAIAIKGGSR
SWLSKTAKKLENSAKKRISEGIAIAIQGGPR
SWLSKTYKKLENSAKKRISEGIAIAIQGGPR
SWLSKTYKKLENSAKKRISEGVAIAILGGLR

SyETP
SYM1
SYM1A
sympathicoblasts
sympathoadrenal progenitor cells
sympathoblasts
sympathocytes
Synantocytes
synantoglial cells
synaptic cleft-1
synaptic LDL receptor-related protein
synarmotic cells
synarmotic neurons
SynB
SynB1
SynB3
SynB5
SynB peptides
synchronised regulated necrosis
synchronized cell death
synchronized necrosis
syncytial cells
syncytial cytotrophoblasts
syncytiotrophoblasts
Synd1
SYND2
Synd3
SYND4
syndecan
syndecan-1
syndecan-2
syndecan-3
Syndecan-4
syndecan proteoglycan 1
syndecan proteoglycan 2
Syndetin
Syndromic microphthalmia-3
synenkephalin
Synergistic activity
Synergistic factor-1
synleurin
synLRP
synonyms
synovial apoptosis inhibitor 1
synovial endothelium targeting peptide
synovial fibroblastoid cells
synovial fibroblasts
synovial lining cells
synovial stimulating protein
synovioblasts
synoviocytes
Synoviolin
synoviomacrophages
SYNS1
Syntaxin-2
Synthokine
Syphaxin
Syphaxin(1-16)
Syphaxin(1-22)
SYSMEHFRWGKPV
SYSMEHFRWGKPVGKKRRPVKVYP
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
SYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
systematic evolution of ligands by exponential enrichment
Systemic inflammatory response syndrome
systemic lupus erythematosus vitiligo-related 1
system-L amino acid transporter 1
SYVN1

SZP



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.