SPG64 |
SPH |
GLKDWVKIAGGWLKKKGPGILKAAMAAATQ |
||
[smallpox growth factor] This growth factor is encoded in the genome of Variola virus (Variola growth factor, Variola virus growth factor) (Kim et al, 2004). The protein contains an EGF-like domain that is conserved among orthopox viral genomes. The protein has been shown to bind to the cellular erbB1 EGF receptor with subnanomolar affinity, stimulating the growth of primary human keratinocytes and fibroblasts. High affinity monoclonal antibodies specific for SPGF provide in vivo immunoprotection in a murine vaccinia pneumonia model by a mechanism distinct from viral neutralization.
CI-1033 and related 4-anilinoquinazolines that target erbB1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |