SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK |
SDF-1 |
Antileukinate |
||
[Stromal cell-derived factor] SDF-1-alpha and SDF-1-beta are small cytokines belonging to the CXC-Chemokines, and they are splice isoforms of the same gene, referred to also as CXCL12-alpha and CXCL12-beta, respectively (Tashiro et al, 1993). The factors have been referred to also as TLSF-alpha [Thymic lymphoma cell stimulating factor-alpha] and TLSF-beta [Thymic lymphoma cell stimulating factor-beta]. The protein is identical also with TPA repressed gene-1. According to a new systematic nomenclature the name CXCL12
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |