S-MAG |
small alveolar cells |
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
||
[smooth muscle cell activation-induced gene-82] de Vries et al (2000) have identified 40 genes that show altered expression in activated human smooth muscle cells. These genes have been designated SMAG [smooth muscle activation specific genes]. These genes are expressed by cultured smooth muscle cells upon stimulation with the conditioned medium of activated macrophages. Sequence analysis shows that SMAG-82 is identical with FGF5.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |