SLTKGRASYTMEFLKYDEAPSNVAQAVIEARGK |
SLUGH |
CUE domain |
||
Human SLUG (also: SLUGH) is a transcription factor belonging to the Snail family of developmental regulatory proteins (Inukai et al, 1999). Human SLUG (approved gene symbol SNAI2 [snail family transcriptional repressor 2; snail homolog 2; abbr. also Snail-2] is a repressor that localizes to sites of active transcription (Hemavathy et al, 2000). SLUG participates in mesoderm formation, neural crest cell migration, carcinogenesis, and apoptosis (Hemavathy et al, 2000).
XSLUG, the Xenopus laevis homolog of SLUG has been shown to directly control the transcription of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |