SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLR |
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAG |
Small Secretory Cells |
||
This peptide, derived from histone H2A, corresponds to Hipposin.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |