COPE Advertising options



Previous Next
Search COPE:
 


- R -

Select one of the following:


r

R1
R1-GI factor

R2
R2G1

R3
R3G1
R3hdml
R3h domain containing-like
R3/I5

R4
R4B2

R7

R8

R9

R13-Ag
R13 antigen
R17 protein

R4-4

r129
r131
r150

RA-A47
RAALPPGFTPFR
RAAPYGVRLCGREFIRAVIFTCGGSRW
RAB3 GDP/GTP exchange protein
Rab3 GEP
rabbit bladder protein 1
rabbit bladder protein 2
rabbit kidney-1
rabbit kidney-2
Rabbit peritoneal factor
Rabbit serum-derived growth inhibitor
rabbit vaginal fluid hemoglobin-alpha peptide
Rab BP-1
Rab BP-2
rabies virus glycoprotein(175-203)
rabies virus glycoprotein(330-357)
rabies virus glycoprotein derived peptide
rabies virus glycoprotein peptide
Rabies virus phosphoprotein
Rabies virus P protein
Rabies virus protein G
RAC1
Race
RA cells
RAD2
Radar
RADHPF
radial epithelial cells
radial glial cells
Radial glial-like cells
Radial glia-like progenitor cells
Radial glia-like type 1 cells
Radial glia-like type 2a cells
Radial glia-like type 2b cells
Radial glia-like type 3 cells
radial glial stop signal molecule 1
radial gliocytes
radial nerve factor
Radical S-adenosyl methionine domain-containing protein 2
Radioimmunoassay
radioprotective protein 105 kDa
radioreceptor assays
RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
RAEAVPPGFTPFRKP
raf
raf1
raf2
rafA
rafB
RAF kinase inhibitor protein
RAGE
RAGLQFPVGRLLRRLLR
RAGLQFPVGRLLRRLLRRLLR
ragocytes
RAGS
RAGS1 antigen
RAI
RAIDD
RAIGGGLSSVGGGSSTIK
RAIGGGLSSVGGGSSTIKY
RAINB1
Raju cells
RAK
RALDH1
RALT
ramified microglial cells
Ramos
Ramos.G6.C10
RAMP1
RAMP2
RAMP3
RAMPs
Ran-2 antigen
Rana-BI
Ranacyclin E
Ranacyclin T
Ranacyclins
Ranakinin
Ranakinin-N
Ranalexin-1Ca
Ranalexin-1Cb
Ranalexin
rancRNAs
Raniseptin-1
Raniseptin-2
Raniseptin-3
Raniseptin-4
Raniseptin-5
Raniseptin-6
Raniseptin-7
Raniseptin-8
Raniseptin-9
Raniseptins
Ranatensin
Rana tigrina ranavirus CARD-like caspase
Ranatuerin-1
Ranatuerin-1C
Ranatuerin-1CBa
Ranatuerin-1CBb
Ranatuerin-1T
Ranatuerin-2
Ranatuerin-2AMa
Ranatuerin-2AMb
Ranatuerin-2AUa
Ranatuerin-2Ca
Ranatuerin-2Cb
Ranatuerin-2CBa
Ranatuerin-2CBc
Ranatuerin-2CBd
ranatuerin-2CHa
ranatuerin-2CHb
ranatuerin-2CHc
ranatuerin-2Ob
ranatuerin-2Oe
Ranatuerin-2P
Ranatuerin-2TRa
Ranatuerin-3
Ranatuerin-4
Ranatuerin-5
Ranatuerin-6
Ranatuerin-7
Ranatuerin-8
Ranatuerin-9
Ranatuerin-CBd
Ranatuerins
RANDAM-2
randomly sequenced cDNA 786
RANK
RANKL
RANKL1
RANKL2
RANKL3
RANK ligand
RANK ligand 1
RANK ligand 2
RANK ligand 3
RANTES
RANTES (1-68)
RANTES (3-68)
RANTES (4-68)
RANTES receptor
RAP
RAP46
RAP46/Hap46
RAP55
RAP55A
Rapamycin
RAPH
RAPH1
Raphanus sativus-antifungal protein 1
Raphanus sativus-antifungal protein 2
Raphanus sativus-antifungal protein 3
Raphanus sativus-antifungal protein 4
Raph blood group
rapidly self-renewing mesenchymal stem cells
RAPS
RAPVPPGFTPFR
RAQEEADAEERRLQ
RAR-1
Ra-reactive factor p28A
RaRF p28A
RARRES2
RASA1
RASA1(158-455)
RASA1 N2 fragment
Ras association domain-containing protein 3
RA-SF
RASF
RasGAP(158-455)
RasGAP(317-326)
Ras GTPase-activating protein
Ras homologue enriched in brain
RASI-1
Ras-induced senescence 1
rasiRNAs
Rasl2-8
RASM
RASMC
Ras of complex proteins domain
rasp
rasp1
RAS p21 protein activator
Ras-related C3 botulinum toxin substrate 1
RASSF3
Rat-activating receptor 1
Rat aortic ring assay
rat aortic smooth muscle cells
rat Heymann nephritis antigen
Rat Insulinoma Gene
rat liver 13k protein
rat neural antigen-2
rat O-acetyl ganglioside synthase
Rattin
Rattusin
RAW117-P cell proliferation inhibitor
RAW264.7
RAWVAWRNR
Raxin

RB6-8C5
Rb-8 neural cell adhesion molecule
Rba
RBBP2H1A
RBC
RBCC
Rbd1
Rbig1
Rb-inhibiting gene 1
RBL-2H3
RBM5
RB neurons
RBP2-H1
RBP2 homolog 1
RBP4
RBTN2
RBTNL1
Rbx-2

RC
RC-1
RC-2
RC-3
RC3
RC3H1
RC3H2
RC38
RC-100
RC-101
RCAS1
RCD
RCECs
R cells
RCF
RCICTRGFC
RCICTTRTCRFPYRRLGTCLFQNRVYTFCC
RCLCRRGVC
rcm
Rco2
RCOR
RCOR1
RCPLSHSLICY

Rd antigen
RDC1
RdCVF
RdCVF2
RdCVF2L
RdCVFL
RDEL
rdgB
RDGBA3
RDGF
RDGF-alpha
RDGF-beta
RDIAEIIKDI
RDP
RDP(330-357)
Rdx

RE
reactive astrocytes
reactive cholangiocytes
reactive lymphocytes
READFFWSLCTADMS
Reaferon
reaper
rearranged during transfection proto-oncogene
Rebetron
rec
RECC
recepteur d'origine nantais
Receptin
receptor activator of NF-kappa-B
receptor activator of NF-kappa-B ligand
receptor activity-modifying protein-1
receptor activity-modifying protein-2
receptor activity-modifying protein-3
receptor alpha chains
receptor-associated late transducer
receptor-associated prorenin system
receptor-associated SMAD
receptor-associating protein 46 kDa
receptor beta chains
receptor binding cancer antigen expressed on SiSo cells
Receptor deorphanization
receptor dog cDNA 1
receptor downregulation
Receptor Expressed in Lymphoid Tissues
receptor for advanced glycosylation end products
Receptor for HA-Mediated Motility
receptor for hyaluronic acid-mediated motility
receptor gamma chains
receptor inducing factor
receptor interacting protein
receptor interacting protein-1
receptor interacting protein-2
receptor interacting protein-2-beta
receptor interacting protein-3
receptor interacting protein-3-beta
receptor interacting protein-3-gamma
receptor interacting protein-4
receptor interacting protein-5
receptor-interacting serine/threonine kinase 1
receptor-interacting serine/threonine kinase 2
receptor-interacting serine/threonine kinase 3
receptor-interacting serine/threonine kinase 4
receptor-interacting serine/threonine kinase 5
receptor-interacting serine/threonine kinase 7
Receptor Internalization and Degradation
receptor mediated label-transfer assay
Receptorphin
receptor protein tyrosine kinases
receptor protein tyrosine phosphatase
receptor protein tyrosine phosphatase-beta
receptor protein tyrosine phosphatase-zeta
receptor-regulated SMAD
receptor shedding
receptor transmodulation
receptor-type protein tyrosine phosphatase
receptor tyrosine kinase
receptor tyrosine kinase 6
receptor tyrosine kinase-like orphan receptor 1
receptor tyrosine kinase-like orphan receptor 2
receptor upregulation
receptosecretory cells
recirculating Memory T-cells
RECK
recombinant cytokines
recombination induced mutation 3
recharging of long-term bone marrow cultures
reconectin
RECS1
Rectin
RED
red blood cells
red cells
REDD1
REDD2
Redelberger antigen
Redelberger blood group antigen
Re-den
red marrow
red milk protein
red-OFF cells
red-ON cells
Redox factor-1
redoxifibromiRs
redoximiRs
redox sensitive microRNAs
red pigment-concentrating hormone
red protein
reduced coat 2
reduced expression 3
reduced expression gene 1
reduced expression in cancer
Reed-Sternberg cells
Reed-Sternberg giant cells
Reed-Sternberg intermediate filament associated protein
Reed-Sternberg microtubule-associated protein
reeler
Reelin
Ref-1
Ref1
REF-1
Refeeding-induced fat and liver protein
REG
Reg1
REG1
REG1A
REG-1-alpha
REG1B
REG-1-beta
REG2
REG3
REG3A
REG3A(104-118)
REG3-alpha
REG3B
REG3-beta
REG3D
Reg3d
REG3-delta
REG3G
REG3-gamma
REG4
Regakine-1
regDCs
Regenerating agents
regenerating gene
regenerating islet-derived-1
regenerating islet-derived-2
regenerating islet-derived-3
regenerating islet-derived-3-alpha
regenerating islet-derived-3-beta
regenerating islet-derived-3-delta
regenerating islet-derived-3-gamma
regenerating islet-derived-4
Regenerating islet-derived protein-1-alpha
regenerating liver nuclear receptor
Regenerating protein
Regenerating protein 1
Regenerating protein 1-alpha
regeneration and tolerance factor
regeneration associated serpin-1
regeneration protein
regenerative cell death
reggie-1
REGL
REG-like
REG-like protein
Regnase-1
REGR
Regranex
REG receptor
regressor cells
regucalcin
regucalcin gene promoter region-related protein
regular chorionic gonadotropin
regular hCG
regular-spiking neurons
Regulated bone marrow adipocytes
regulated by nitric oxide
regulated by nitric oxide-2
regulated cell death
regulated in development and DNA damage response 1
regulated in development and DNA damage response 2
Regulated necrosis
regulated upon activation normal T-cell expressed, and presumably secreted
regulator of cell cycle
regulator of cullins-2
Regulator of FAS induced Apoptosis
regulator of G-protein signaling 4
regulator of G-protein signaling 5
Regulator of G-protein Signaling domain
regulator of ubiquitous kinase
regulatory B-cells
regulatory dendritic cells
regulatory ILCs
regulatory immune cells
regulatory innate lymphoid cells
regulatory macrophages
regulatory myeloid cells
Regulatory NK-cells
regulatory non-coding RNAs
regulatory peptide factors
Regulatory plasma cells
regulatory protein T-lymphocyte-1
Regulatory RNase 1
regulatory T-cells
Regulatory T-cells induced by B-cells
regulatory T-lymphocytes
REIC
Reissner’s fiber glycoprotein I
Rek4
Rek5
Rek7
RelA
RelA-associated inhibitor
Relaxin
relaxin 1
relaxin 2
relaxin 3
relaxin 3a
relaxin 3b
relaxin 3 receptor 1
relaxin 3 receptor 2
relaxin 1/2
relaxin C
relaxin D
relaxin E
relaxin F
relaxin family peptide receptor 1
relaxin family peptide receptor 2
relaxin family peptide receptor 3
relaxin family peptide receptor 4
relaxin H1
relaxin H2
relaxin H3
Relaxin/insulin-like factor 1
Relaxin/insulin-like factor 2
relaxin-like factor
relaxin-like gonad-stimulating peptide
relaxin-like peptide family
relaxin receptor
RELAY
relay neurons
RelB
Released cytotoxic factor
releasing factor of luteinizing hormone
RELEELNVPGEIVESLSSSEESITRINK
Rel homology domain
Relish
RELM
RELM-alpha
RELM-beta
RELM-gamma
RELN
Rel-N1
Rel-N2
RELP
RELT
Remak bundle Schwann cells
Remak bundles
Remak cells
Remak fibers
Remak Schwann cells
REM-off cells
REM-on cells
remote cell death
REN
Ren1
Ren1c
Ren1d
Ren2
REN-4
REN-9
REN-11
REN-27
REN-46
REN-47
REN-51
REN-64
Renalase(220-239)
Renalase
renal brush-border neutral proteinase
Renal carcinoma antigen NY-REN-4
Renal carcinoma antigen NY-REN-9
Renal carcinoma antigen NY-REN-11
Renal carcinoma antigen NY-REN-27
Renal carcinoma antigen NY-REN-42
Renal carcinoma antigen NY-REN-44
Renal carcinoma antigen NY-REN-46
Renal carcinoma antigen NY-REN-47
Renal carcinoma antigen NY-REN-51
Renal carcinoma antigen NY-REN-59
Renal carcinoma antigen NY-REN-64
renal inhibitory factor
renal intercalated cells
renal juxtaglomerular cells
renal principal cells
renal vascular smooth muscle cells
RENBP
Rendu-Osler-Weber syndrome
Renin
Renin 1
Renin-2
Renin-a
renin-angiotensin system
Renin-b
Renin-binding protein
Renin cells
Renin lineage cells
Renin-producing cells
renin/prorenin receptor
renin receptor
renocortin
renocytes
renoguanylin
Renotropin
RENR
Renshaw cells
reovirus p10 protein
Repair Schwann cells
repeat associated small interfering RNAs
REPELL macrophages
REPELL-microglia
Repifermin
Replication and transcription activator
replication associated protein
replicative aging
replicative senescence
repressor of PRKR inhibitor
reproductive cell death
reproductive cells
reprogramming
reprogramming factors
reprolysins
repulsive axon guidance signal
repulsive guidance molecule
repulsive guidance molecule A
repulsive guidance molecule B
repulsive guidance molecule C
REQ
Requiem
RERF
RESA1
Resazurin
reserve cells
reserve chondrocytes
reserve stem cells
resident cells
resident macrophages
resident Memory T-cells
resident monocytes
residual blasts
Resistin
Resistin-like alpha
Resistin-like beta
Resistin-like gamma
resistin-like molecule-alpha
resistin-like molecule-beta
resistin-like molecule-gamma
Resistin-like molecules
resolution-associated molecular patterns
resolution-phase macrophages
resolution-phase interaction products
Resolvin D2 receptor
Resolvin E1
resolvins
Respiratory chain assembly factor 1
Respirovirus V protein
response elements
response gene to complement 32
responsive cytokines
responsive to centrifugal force and shear stress 1
REST corepressor
REST corepressor 1
Restin
Restin-1
Restin-2
Restin-3
Restin-4
resting regulatory T-cells
Restins
resting cells
resting wandering cells
Restrictin-P
Restrictins
restriction factor 1
Restrictocin
RET
RET9
RET43
RET51
RETAINED
retained-intron circRNAs
Retbindin
Ret finger protein
Reth motif
reticular cells
Reticular fibroblastic cells
reticulated platelets
reticulocytes
reticuloendothelial cells
reticulo-fibroblastoid colony-forming cells
reticulo-fibroblastoid colony-forming units
Reticulon-3
reticulon-3A1
reticulon-3A2
reticulon-3A3
reticulon-3A3a
reticulon-3A3b
reticulon-3A4
reticulon-3A4a
reticulon-3A4b
reticulon-3B
reticulon-3C
reticulon-4
reticulon 4 receptor
reticulon 4 receptor-like 1
reticulon 4 receptor-like 2
Reticulophagy
reticulum cells
Retina bipolar cells
retina bipolar neurons
Retina-derived growth factor
Retina-derived growth factor-alpha
Retina-derived growth factor-beta
retinal capillary endothelial cells
retinal cone cells
retinal degeneration B
retinaldehyde dehydrogenase 1
retinal dehydrogenase 1
retinal ganglion cell growth cone collapsing factor
retinal ganglion cells of Dogiel
retinal ganglion M cells
retinal ganglion P cells
retinal glial cells
retinal gliocytes
Retinal macular dystrophy 2
retinal microvascular endothelial cells
Retinal Müller glia
retinal pigmented cells
Retinal pigment epithelial cell-derived superoxide suppressive factor
retinal pigment epithelial cell factor-1
retinal pigment epithelial protective protein
Retinal pigment epithelium cells
Retinal rod cells
retinal spheres
retinitis pigmentosa 10
retinitis pigmentosa 36
retinitis pigmentosa type 38
Retinitis pigmentosa 41
retinoblastoma-binding protein 2 homolog 1A
retinoblastoma-derived growth factor
Retinoblastoma-inhibiting gene 1 protein
Retinoic acid- and interferon-inducible 58 kDa protein
retinoic acid induced E
Retinoic acid inducible gene-G
Retinoic acid inducible gene-I
retinoic acid inducible gene-I-like receptors
retinoic acid inducible in neuroblastoma cells
retinoic acid inducible skin-specific 1
Retinoic acid-inducible heparin binding protein
retinoic acid receptor responder 2
Retinoid-binding protein
retinol binding protein 4
retinophilin
Retinoschisin
retinospheres
RETL1
RETL2
RET ligand 1
RET ligand 2
retn
RETN
RETN1
Retnla
Retnlb
Retnlg
retro-all-D peptide analogs
retrocrine
retrocylin
retrocyclin-1
retrocyclin-2
retrocyclin-3
retrocyclins
retrodifferentiation
retroenantio peptide analogs
retrograde differentiation
Retro-inverso D5
Retro-inverso peptides
retro-inverso-peptidomimetics
retroprogrammation
Retrotrophin
Retzius cells
REUL
Rev4
Rev(34-50)
reversal cells
reversal of apoptosis
reversal/osteoprogenitor cells
reverse durotaxis
Reverse hemolytic plaque assay
Reversion-inducing Cysteine-rich Protein with Kazal Motifs
revised granulocyte/macrophage progenitors
Rev peptide
REX1
Rex3
Rex denuded

RFamide-related peptide-1
RFamide-related peptide-2
RFamide-related peptide-3
RFamide-related peptides
RFamides
RFGIPMDRIGRNRLSNSRG
RF-GlyI
RFI
RFLH
RF-M1
RF-M2
RFP
RFRP
RFRP-1
RFRP-2
RFRP-3
RFRPPIRRPPIRPPFYPPFRPPIRPPIFPPIRPPFRPPLGPFP
RFWD1

RG-1192
RG-1503
RG13022
RG14620
RG50810
RG50858
RG50862
RG50864
RG50872
RG50875
Rg blood group antigen
RGC-32
RGCC
RG cells
RGC growth cone collapsing factor
Rg/Ch antigen
RGCs
RGD
RGD-4C
RGD-CAP
RGD-containing collagen-associated protein
RGDLATLRQLAQEDGVVGVR
RGD-Tachyplesin
RGERPPR
RGFRKHFNKLVKKVKHTISETAHVAKDTAVIAGSGAAVVAATamide
RGGGLCYCRRRFCVCVGR
RGGRLAYLRRRWAVLGR
RGGRLCYCRGWICFCVGRamide
RGGRLCYCRRRFCICVamide
RGGRLCYCRRRFCVCVGRamide
RGGRLSYSRRRFSTSTGR
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
RGLs
RGM
RGMa
RGMb
RGMc
RGM domain family member A
RGM domain family member B
RGM domain family member C
rGMPs
RGN
RGP
RGPR
RGPR-p117
RGS4
RGS5
RGSALTHLP
RGS domain
RGTA

rh
RH2
Rh30D
Rh30CE
Rh36
Rh50
Rh50a
RH116
Rh-123
RHA
Rhabdomeric photoreceptor cells
rhabdomyosarcoma homing peptide 1
rhabdomyosarcoma homing peptide 2
rhabdomyosarcoma homing peptides
RHAG
RHAG1
RHAG2
RHAG3
RHAG blood group system
RHAMM
RHAMM-48
RHAMM-147
RHAMMFL
Rhamp
Rh antigen
Rh-associated glycoprotein
Rh-associated glycoprotein 2
Rh-associated protein
RHAU
RHBDD3
RHD
Rheb
Rhesus-associated polypeptide 50 kDa
Rhesus-associated polypeptide 50 kDa a
Rhesus blood group-associated ammonia channel
Rhesus blood group-associated glycoprotein
Rhesus cytomegalovirus Rh36
rhesus macaque rhadinovirus IL6
Rhesus rhadinovirus IL6
Rhesus rhadinovirus orf74
Rhesus Theta-Defensin-1
Rhesus Theta-Defensin-1a
Rhesus Theta-Defensin-1b
Rhesus Theta-Defensin-2
Rhesus Theta-Defensin-3
Rheumatoid arthritis antigen A47
rheumatoid arthritis cells
rheumatoid arthritis synovial fibroblasts
rheumatoid arthritis phagocytes
Rheumatoid arthritis synovial fluid
Rheumatoid arthritis synovium inflamed-1
RHG
RHG proteins
RH II/Gu
Rhinocerosin
rhinophrynin-33
rhinophrynin-27
rhinovirus receptor
Rhipicephalus haemaphysaloides antimicrobial peptide
Rhipicephalus sanguineus chemokine binding protein
Rhodamine-123
rhodopsin-like G-protein-coupled receptors
Rhodostomin
RhoGEF domain
rhogocytes
Rho GTPase-activating protein 7
RHOM2
rhomboid domain containing 3
Rhombotin-2
Rhombotin-like-1
RHPA
Rh polypeptide 1
Rh polypeptide 2
Rh-related antigen
RHRTPMFYGLMamide
rhu

RI18 peptide
RI58
RIA
ribonuclease-2
ribonuclease 3
ribonuclease 4
ribonuclease 5
Ribonuclease 6
ribonuclease 3(1-45)
ribonuclease A family 5a
ribonuclease A family 5b
ribonuclease A family 5c
ribonuclease A family 5d
ribonuclease A family 2
ribonuclease A family 3
ribonuclease A family 5
ribonuclease A family 7
ribonuclease A family 8
Ribonuclease/angiogenin inhibitor
ribonuclease/angiogenin inhibitor 1
ribonuclease inhibitor 2
ribonuclease P RNA component H1
Ribonucleases with special biological action
ribonuclease T
ribonuclease T2
Ribonucleotide reductase
ribophagy
ribosomal protein L1
ribosomal protein L3
ribosomal protein L5
ribosomal protein L7
ribosomal protein L7a
ribosomal protein L11
ribosomal protein L13
ribosomal protein L13a
ribosomal protein L17
ribosomal protein L22
ribosomal protein L23
ribosomal protein L26
ribosomal protein L27
ribosomal protein L29
ribosomal protein L30
ribosomal protein L31
ribosomal protein L32
ribosomal protein L35
ribosomal protein L36A
ribosomal protein L40
ribosomal protein large P0
ribosomal protein large P2
ribosomal protein P0
ribosomal protein P2
ribosomal protein S3
ribosomal protein S3a
ribosomal protein S4
ribosomal protein S6
ribosomal protein S7
ribosomal protein S12
ribosomal protein S13
ribosomal protein S14
ribosomal protein S15
ribosomal protein S19
ribosomal protein S21
ribosomal protein S23
ribosomal protein S29
ribosomal protein S30
ribosomal protein SA
Ribosomal RNA-processing protein 46
Ribosome-associated small ncRNAs
Ribosome-associated small non-coding RNAs
Ribosome-bound small ncRNAs
Ribosome-bound small non-coding RNAs
RICK
rickets
RICRCICGRRICRCICGR
RICTAIPLPMCL
RICTPIPFPMCY
RICYAMWIPYPC
RID
Rieder cells
Rieder's lymphocytes
RIF
RIF1
Rif2
RIFF
RIFL
RIFSKIGGKAIKNLILKGIKNIGKEVGMDVIRTGIDVAGCKIKGEC
Rift Valley fever virus NSm protein
Rift Valley fever virus NSs protein
Rig
Rig1
RIG-E
RIG-G
RIG-I
RIG-I E3 ubiquitin ligase
RIG-I inflammasome
RIG-I-like receptor 2
RIG-I-like receptor 3
RIG-I-like receptors
Rigin
RIHB
RIIDLLWRVRRPQKPKFVTVWVR
RIKPHE
RILSILRHQNLLKELQDLAL
RILTMTKRVKMPQLYKQIVCRLFKTC
Rim3
rimorphin
Rinderpest virus C protein
Rinderpest virus phosphoprotein protein
Rinderpest virus P protein
Rinderpest virus V protein
Ring1 and YY1 binding protein
RING box protein-2
ring cells
RING domain
ringelschwanz
RING finger
RING finger and C3H zinc finger protein 1
RING finger and C3H zinc finger protein 2
RING finger and CCCH-type domains 1
RING finger and CCCH-type domains 2
ring finger and WD repeat domain-containing protein 1
RING finger homologous to inhibitor of apoptosis protein
RING finger protein 7
RING finger protein 13
RING finger protein 16
RING finger protein 19B
RING finger protein 22
RING finger protein 23
RING finger protein 34
RING finger protein 43
RING finger protein 45
RING finger protein 47
RING finger protein 48
RING finger protein 49
RING finger protein 50
RING finger protein 51
RING finger protein 76
RING finger protein 81
RING finger protein 83
RING finger protein 84
RING finger protein 85
RING finger protein 88
RING finger protein 97
RING finger protein 109
RING finger protein 114
RING finger protein 119
RING finger protein 124
RING finger protein 125
RING finger protein 128
RING finger protein 135
RING finger protein 136
RING finger protein 137
RING finger protein 146
RING finger protein 147
RING finger protein 152
RING finger protein 162B
RING finger protein 162C
RING finger protein 177
RING finger protein 186
RING finger protein 194
RING finger protein 198
RING finger protein 206
RING finger protein 216
RING finger protein leading to RIG-I activation
ring neurons
RING zinc finger
RINKK
RINm5F
RIP
RIP1
RIP2
RIP2-beta
RIP3
RIP3-beta
RIP3-gamma
RIP4
RIP5
RIP25
Riparin 1.4
Riparin 2.1
Riparin 5.1
Riparins
RIP associated Ich-1/CED homologous protein with death domain
RIPK1
RIPK1-dependent PANoptosomes
RIPK2
RIPK3
RIPK4
RIPK5
RIPK7
Riplet
RIPlike interacting CLARP kinase
ripoptosome
RIRDAIAHGYIVDKV
RIS1
RIS-1
RISBASES
RISC

RJD6

rk
RK-1
RK-2
RK-13
RK-31
RK-BARF0
RKCNFLCKLKEKLRTVITSHIDKVLRPQG
RKCVRVQLIKNGKKITAF
RKDVY
RKEVY
RKFHEKHHSHRGY
RKFHEKHHSHRGYR
RKFHEKHHSHRGYRSNYLYDN
RKFHEKHHSHREFPFYGDYGSNYLYDN
RKGWFKAMKSIAKFIAKEKLKEHL
RKIP
RKKRRQRRR
RKKRRRESRKKRRRES
RKKRRRESRRARRSPRHL
RKKTRKRLKKIGKVLKWIamide
RKRLQVQLSIRT
RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
RKSYKCLHKRCR

RL
RL-37
RL-388
RLARIVVIRVAR
RLC34
RLCRIVVIRVCR
RLF
RLFKCWKKDS
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
RLKELITTGGQKIGEKIRRIGQRIKDFFKNLQPREEKS
RLN
RLN1
RLN2
RLN3
RLN3R1
RLN3R2
RLNR
R-LPS
RLPSYGHSFLamide
RLR-2
RLR-3
RLRFD
RLRFH
RL-RL10 peptide
RLRLLTLQSWLL
RLRs
RLVG
RLX
RLXH1
RLXH2
RLXH3

RM3/1
RMAPEEIIMDRPFLFVVR
RMECs
RMG cells
rmh
RMKKLGNHKVSCERNTKRCRKAI
RMRP
RMRP-S1
RMRP-S2
RMS-I
RMS-II
RMYEE

RN7SK
RN7SL
RN7SL1
RN3(1-45)
RNA-associated protein 55
RNA-associated protein 55A
RNA binding motif protein 5
RNA component of mitochondrial RNA processing endoribonuclease
RNA editing
RNA editing core complex
RNA editing deaminases
RNA granule protein 140
RNA helicase 2
RNA helicase 116
RNA helicase A
RNA helicase associated with AU-rich element ARE
RNA helicase-DEAD box protein 116
RNA helicase II/Gu
RNA hyper-editing
RNAi
RNA-induced silencing complex
RNA interference
RNA polymerase II-associated protein 3
RNA polymerase III
RNA polymerase III subunit C9
RNASE1
RNASE2
RNASE3
RNASE4
RNASE5
Rnase5a
Rnase5b
Rnase5c
Rnase5d
RNASE6PL
RNASE7
RNASE8
RNase MRP
RNase P
RNAse superfamily
RNASE T2
RNASET2
RNASET2(A103-Q159)
RNASET2(K108-K133)
RnBP
RNCAM
RNCMEVCVKGEKKHTGQGMIRRLRRNKNNSIFVVRKRV
R-neurons
RNF
RNF7
RNF13
RNF16
RNF19B
RNF22
RNF23
RNF34
RNF43
RNF45
RNF47
RNF48
RNF49
RNF50
RNF51
RNF76
RNF81
RNF83
RNF84
RNF85
RNF88
RNF97
RNF109
RNF114
RNF119
RNF124
RNF125
RNF128
RNF135
RNF136
RNF137
RNF146
RNF147
RNF152
RNF162B
RNF162C
RNF177
RNF186
RNF194
RNF198
RNF206
RNF216
Rng140
RNH
RNH1
RNH2
RNKP1
RNKP4
RNLS
RNM561
RNO
RNO-2
RNPDGDAKPW
RNPRGEEGGPW
RNR-1
RNR2
RNRRWCIDQQA
RNS2
RNS3
RNS4
RNSRP1
RNY1
RNY3
RNY4
RNY5

Ro52
Ro52/TRIM21
Ro60-associated RNA Y1
Ro60-associated RNA Y3
Ro60-associated RNA Y4
Ro60-associated RNA Y5
roadkill
Ro antigen
Robertson-Hortega cells
robo
Robo-1
Robo-2
Robo-2a
Robo-2b
Robo-3
Robo-3a
Robo-3b
Robo-4
Robo-3.1
Robo-3.2
ROC-2
ROC domain
rod amacrine cells
Rod bipolar cells
rod cells
Rod-derived cone viability factor
Rod-derived cone viability factor 2
Rodent herpesvirus Peru R17 protein
rodent mesenteric window angiogenesis assay
Rodgers blood group antigen
Rodgers/Chido blood group
Rodlet cells
rod microglia
rod-like microglia
Rod microglial cells
rod photoreceptor cells
rod photoreceptors
Roferon A
Rohon-Beard cells
Rohon-Beard neurons
Rolando cells
Romurtide
RON
rondonin
Ronin
roof plate-specific spondin
Roof plate-specific spondin-2
Roof plate-specific spondin-3
Roof plate-specific spondin-4
root cells
root sheath cells
ROQ domain
Roquin
Roquin-1
Roquin-2
ROR1
ROR2
ROR-gamma-t(+) FoxP3(+) biTregs
ROR-gamma-t(+) FoxP3(+) T-cells
Rorsin-1
Rorsin-2
ROSA
ROSA(KIT D816V)
ROSA(KIT WT)
rosette receptor
Ro/SS-A autoantigen
Ross River virus 6K protein
Rostral cerebellar malformation protein
Rotamase A
Rotamase A(22-39)
Rotamase A(23-39)
Rotamase A(26-39)
Rotamase A(63-92)
Rotamase A(84-100)
Rotavirus capsid protein VP7(94-107)
Rotavirus non-structural protein 4
Rotavirus NSP4
Rouget cells
rough lipopolysaccharides
rough LPS
roundabout
roundabout-1
roundabout-2
roundabout-3
roundabout-4
roundabout homolog 1
roundabout homolog 2
Roundabout-like protein 3
Royalactin
Royalisin
RoY peptide

Rp8
RP9 peptide
RP10
RP-27 peptide
RP36
RP38
RP41
RP105
RP-220
RPAP3
RPARPAR
RPCH
RPD-1
RPE cell factor
RPE cells
RPEL1
RPEL domain
RPEL motif
RPEL repeat containing 1
RPESALLGGSEAGERLLQQGLAQVEA
RPF
RPGLLDLK
RPI.4610
RPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRS
RPKHPIKH
RPKHPIKHQ
RPKHPIKHQGLPQEVLNENLLRF
RPKPQQF
RPKPQQFFGLMamide
RPL1
RPL3
RPL5
RPL7
RPL7A
RPL11
RPL13
RPL13a
rpL17
RPL22
RPL23
RPL26
RPL27
RPL29
RPL30
RPL31
RPL32
RPL35
RPL36A
RPL40
RPLKPW
RpLP0
RpLP2
RPMI 1788
RPMrel peptide
Rpn10
RPP
RPP2
RPPGF
RPPGFSPF
RPPGFSPFR
RPPGFSPFRIY
RPPH1
RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR
rpr
RPRPNYRPRPIYRPamide
RPS3
Rps3a
RPS4
RPS4X
RPS4Y
rps6
RPS7
RPS12
RPS13
RPS14
RPS15
RPS19
RPS21
RPS23
RPS29
RPS30
rpS30-2
RPS12(2-24)
RPS15(43-65)
RPS21(63-83)
RPS21(73-83)
RPS21(74-83)
RPSA
RPSFASWGamide
RPT-1
RPTK
RPTP
RPTPB
RPTP-beta

RQAQGWNKFRGAWamide
RQIKIFFQNRRMKFKKamide
RQIKIWFQNRRMKWKKamide
RQIRRWWQRamide
RQRVDDLSKFSKKGAAARRRK
RQVFQVAYIIIKA
RQYDPVAALFFFDIDL

RR1
RR 1/1 antigen
RRA
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
RRETAW
RRFKLLSHSLLVTLASHL
RRFSRGLKRKHLALIKKLRKAKK
RRGCFRVCYRGFCFQRCR
RRHCIKKCMKSRKHNERMIRIRRK
RRIDCKVFVFAPICRGVAA
RRIRPRPPRLPRPRPR
RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFP
RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFPRPGPRPIPRPLPFPRPGPRPIPRP
RRKPLFPFIPRPK
RRKRRRRRK
RRL
rrl antigen
RRLSYSRRRF
RRLTLRQLLGLGSRRRRRSRamide
Rrp46
RRPRCFCRLHCRC
RRPYIL
RRQRRTSKLMKRGG
RRQRRTSKLMKRGGKLAKLAKKLAKLAK
RRRPRPPYLPR
RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPamide
RRRRRRRR
RRRRRRRRR
RRRRNRTRRNRRRVR
RRSRRGRGGGRRGGSGGRGGRGGGGRSGAGSSIAGVGSRGGGGGRHYA
RRV orf74
RRV IL6
RRWCFRVCYKGFCYRKCRamide
RRWCFRVCYRGFCYRKCRamide
RRWQW
RRWQWR
RRWQWRMKK
RRWQWRMKKLG
RRWWCRamide

rs
RS1
RSAD2
Rs-AFP1
Rs-AFP2
Rs-AFP3
Rs-AFP4
rsc786
RS cells
rse
RSGI
RSGPPGLQGRLQRLLQASGNHAAGILTMamide
RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG
RSIY-11
RSLQDTEEKSRSFSASQADPLSDPDQMNED
RSLWSDFYASASRGP
R-SMAD
RSMRLSFRARGYGFR
RSMRLSFRARGYGFRGPGLQL
RSMRLSFRTRGYGFRDPGLQL
RS-MSC
RSN
RSNKGFNFMVDMIQALSK
Rspo
Rspo-1
Rspo2
Rspo3
Rspo4
R-spondin
R-spondin-1
R-spondin-2
R-spondin-3
R-spondin-4
R-spondins
RSRSRDRRRK
RSRTRQFYGLMamide
RSSCFGGRIDRIGAQSGLGCNSFR
RSSCFGGRIDRIGAQSGLGCNSFRY
RSTDLPGLKAATHYTITIRGVC
RSTEDIIKSISGGGFLNAMNAamide
RSTN
RSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLE
RSVCRQIKICRRRGGCYYKCTNRPY
RSV Glycoprotein G
RSV induced factor

RT2 peptide
RT6
RT53 peptide
RT6.1
RT6-1
RT6.2
RT6-2
RTA
RTBDN
rtCATH-1
RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC
RTCIPIPLVMC
RTCIPIPPVCF
RTCMKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
RTD-1
RTD-1a
RTD-1b
RTD-2
RTD-3
RTF
RTI40
RTKs
RTK6
RTK-like orphan receptor 1
RTK-like orphan receptor 2
RTN3
RTN3A1
RTN3A2
RTN3A3
RTN3A3a
RTN3A3b
RTN3A4
RTN3A4a
RTN3A4b
RTN3B
RTN3C
RTN3/HAP
RTN4
RTN4R
RTN4RL1
RTN4RL2
rtp
RTP801
RTP801L
RTP801-like
RT-PCR
RT-PCR quantitation of cytokines
RTSN
rTregs
R-type lectins

Rubicon
Rubiscolin-5
Rubiscolin-6
Rubiscolins
rubriblasts
rubricytes
Rubulavirus V protein
Ruditapes philippinesis defensin-1
Ruffini's flask cells
Rugosin A
Rugosin A-like
Rugosin B
Rugosin C
Rugosins
Ruk
RUN and SH3 domain containing 1
rundataxin
RUN domain and cysteine-rich domain containing Beclin 1-interacting protein
RUN domain and cysteine-rich domain containing protein
RUN domain Beclin-1 interacting and cysteine-rich containing protein
RUN domains
RUSC1

Rv1196
Rv2145c
RVAAAAITWVPKPNVEVWPVDPPPPVNFNK
RVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHW
RVALPPGFTPFR
RVCFAIPLPICHamide
RVCSAIPLPICHamide
RVCYAIPLPIC
RVCYAIPLPICYamide
RvD2 receptor
RVD-Hemopressin
RVD-Hemopressin-alpha
RVD-Hp(1-9)
RVD-Hp-alpha
RVDPVNFKFLSH
RVDPVNFKLLSH
RvE1
RvE1 receptor
RVER1
RVF
RVFHbalphaP
RVFV NSm
RVFV NSs protein
RVG(175-203)
RVG peptide
RVIEVVQGACRAIRHIPRRIRQGLERIL
RvIL6
RVKRFWPLVPVAINTVAAGINLYKAIRRK
RVKRVWPLVIRTVIAGYNLYRAIKKK
RVSMC
RVVAP
RVVDLMAYMASKE
RVYIHPF

RWCFRVCYRGICYRKCRamide
RWCVYAYVRIRGVLVRYRRCW
RWCVYAYVRVRGVLVRYRRCW
RWGKWFKKATHVGKHVGKAALTAYLamide
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVKamide

RXFP1
RXFP2
RXFP3
RXFP4
RXFPR1
RXFPR2
RXFPR3
RXFPR4
RXN1
RXN2
RXN3

RY2G5
RYA3
RYamides
RYBP
RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL
ryk
ryk1
RYLGYL
RYLGYLE
RYLPT
RYPAVGYT
RYRWRCKNQN
RYSR
ryudocan
RYYGY

RZF



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.