SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
SGIV-IGF |
Hro-eve |
||
abbr. for Secretogranin-4. abbr. also: SCG4. This protein is one of the secretogranins. See: Granins.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |