COPE Media Kit


Cope Home
Previous entry:
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Next entry:
S-LPS
Random entry:
Cytokine responsive gene-1
Search COPE:

SLPI

[secretory leukocyte protease inhibitor] (Zitnik et al, 1997). This protein has been aidentified originally as antileukoproteinase (abbr. ALP) (Seemuller et al, 1986). Thompson and Ohlsson (1986) have reported the amino acid sequence. The gene has been cloned by Heinzel et al (1986). The inhibitor shows strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. This inhibitor has been described under a variety of names, including HUSI-I [human seminal plasma inhibitor-I], seminal plasma inhibitor, BLPI [Bronchial leukocyte proteinase inhibitor] MPI, [Mucus proteinase inhibitor], BMI [ ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=46769