SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL |
S-LPS |
Cytokine responsive gene-1 |
||
[secretory leukocyte protease inhibitor] (Zitnik et al, 1997). This protein has been aidentified originally as antileukoproteinase (abbr. ALP) (Seemuller et al, 1986). Thompson and Ohlsson (1986) have reported the amino acid sequence. The gene has been cloned by Heinzel et al (1986). The inhibitor shows strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. This inhibitor has been described under a variety of names, including HUSI-I [human seminal plasma inhibitor-I], seminal plasma inhibitor, BLPI [Bronchial leukocyte proteinase inhibitor] MPI, [Mucus proteinase inhibitor], BMI [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |