Ser9-orcokinin |
Ser-Ala-Glu-Phe-Pro-Asp-Phe-Tyr-Asp-Ser-Gly-Glu-His-Leu-Ser-Pro-Arg |
DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY |
||
[Schwann cell-specific EGF-like repeat autocrine factor] The gene encoding this factor is expressed in precursor cells of avian embryo Schwann cells and appears to be a marker of the earliest phase of the differentiation of Schwann cells. The gene encodes a secreted factor that acts on Schwann cells in an autocrine manner. The secreted protein binds to neural crest cells and Schwann cells, and affects the distribution of Schwann cells, when these cells are introduced to chicken embryos during neural crest migration (Wakamatsu et al, 2004).
A highly related protein has been identified in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |