COPE Advertising options



Previous Next
Search COPE:
 


- H -

Select one of the following:


h

H1
H1f1
H1f5
H1 relaxin
H1 RNA
H1 targeting peptide
H1var3
H1var5

H 2
H2AFB1
H2AFX
H2A histone family member B1
H2A histone family member X
H2AX
H2-M3
H2 relaxin
H2RSP

H3L
H3 relaxin

H4
H4R
h4r

H5
H5R protein

H6 non-histone chromosomal protein

H7

H8

H9

H16G2
H16 peptide
H19

H23
H23 ETA

H3-6 peptide
H37
H3-7 peptide

H6-3C4 antigen
H69-derived immunosuppressive factor

H83
H89

H174

H218

H400
H411

H5-13 peptide
H5-14 peptide
H572 antigen

H731

H963

H460.1 peptide

H7365

H1299.1 peptide
H1299.2 peptide
H1299.3 peptide

H2009.1 peptide

H33342

H4(86-100)
H4(89-102)

HA
HA1A2
HA4
HA4/pp120
HAAESEKERAGQGVLTEEEEKELENLAAMDLELQ
HABP1
Habu snake VEGF
HAC-1
H/ACA Box RNAs
H/ACA Box small nucleolar RNAs
H/ACA RNAs
HaCaT UV-repressed
HaCaT UV-repressible serpin
HACBP
Hades
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
HADGVFTSDFSKLLGQLSAKKYLESLM
HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
HADHB
Hadrurin
HAE1
HAE2
HAECs
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Haeir-PVK/CAP2b-1
Haeir-PVK/CAP2b-2
Haemaphysalis longicornis midgut defensin
Haemaphysalis longicornis salivary gland defensin
Haemonectin
Haemophilus ducreyi Cytolethal distending toxin
haemorrhagic telangiectasia type 1
HAF
hAG-2
Hageman factor
HAHKLRVDPVNFKLLSH
HAI
HAI-1
HAI-1A
HAI-1B
HAI-2
HAI2/PB
HAI-2-related small peptide
hainanenin-1
hainanenin-2
hainanenin-3
hainanenin-4
hainanenin-5
hainanenins
hair cells
hair follicle dermal papilla cells
hair follicle sheath cells
hairy cells
Hairy-related transcription factor-2
HAKA1
Hakata antigen
H-ALBP
half-tRNAs
Halictine 1
Halictine 2
halictines
Halo cells
Halocidin
Halocyntin
halophilic ionocytes
HAM.4
HA-mac macrophages
HAMLET
HAMLET-like compounds
Hammer toe
HAMP
Hamp1
Hamp2
HAMs
hand mirror cells
Hansemann macrophages
Hanukah factor
Hanukah factor serine protease
Hap
HAP
HAP1
HAP-1
hAP10
Hap46/BAG1M
Hap50/BAG1L
HAPO
Happyhour
hapten X
hapten Y
Haptoglobin
haptoglobin-alpha
haptoglobin-alpha-1
haptoglobin-alpha-2
haptoglobin-alpha 1-1
haptoglobin-alpha 2-2
haptoglobin-beta
Haptoglobin inducing activity
Haptoglobin type 1-1
Haptoglobin type 2-2
Haptoglobin type 1-2
Haptotaxin
Haptotaxis
Harakiri
Ha-Ras homolog 2
Ha-Ras pseudogene
HARE
HA receptor for endocytosis
Harlequin
Harlequin molecules
Harmoniasin
HARP
Harriottin-1
Harriottin-2
Harriottin-3
Harriottins
HARS
HAS303
HASF
HASMC
Hassal's corpuscule epithelial cells
HATH domain
H+-ATP synthase
HATs
Hau-Pax3/7A
Hau-Pax3/7B
HAVCR
HAVCR1
HAVCR2
HAV receptor
HAX-1
Haxin

HB8
HB9
HB15
HB24
HB-107
Hb40-61a
Hb(98-114)
HbA
HBA1
HBA2
HBA-71
HbA(1-11)
HbA(1-29)
HbA(1-30)
HbA(1-31)
HbA(1-32)
HbA(1-33)
HbA(3-19)
HbA(32-93)
HbA(33-38)
HbA(33-46)
HbA(33-61)
HbA(33-61a)
HbA(34-68)
HbA(40-61)
HbA(88-112)
HbA(97-114)
HbA(98-114)
HbA(106-141)
HbA(107-136)
HbA(107-141)
HbA(110-125)
HbA(110-141)
HbA(129-134)
HbA(133-138)
HbA(133-141)
HbA(134-140)
HbA(134-141)
HbA(135-141)
HbA(137-138)
HbA(137-141)
HbAHP-25
Hb-associated macrophages
HBAZ
HbB
HbB(1-10)
HbB(1-29)
HbB(1-30)
HbB(1-33)
HbB(1-41)
HbB(31-36)
HbB(32-39)
HbB(32-40)
HbB(32-41)
HbB(33-37)
HbB(33-38)
HbB(33-41)
HbB(33-95)
HbB(35-41)
HbB(99-110)
HbB(111-146)
HbB(115-146)
HbB(116-148)
HbB(126-145)
HbbetaP-1
HBBM
HBc
HBc147-183
HbD
HBD-1
HBD-2
HBD-3
HBD-4
HBE
HBE1
HB-EGF
HB-EGF(30-51)
HB-EGF-C
HBEGFGF
HbF
HBG1
HBG2
HB-GAF
HB-GAM
HBGF
HBGF-0.8
HBGF-0.8-P1
HBGF-0.8-P2
HBGF-1
HBGF-1U
HBGF-2
HBGF-3
HBGF-4
HBGF-5
HBGF-6
HBGF-7
HBGF-8
HBGF-9
Hb-Gower 1
Hb-Gower 2
HBL-6
HBMECs
HBNF
HBNF-a
HBNF-b
HBNF-c
Hbp
HBP
HBp15
HBp17
HBp17-related protein
HBP17RP
HBP23
hBSMC
HBSP
HbSR
HBV core protein
HBV core protein arginine-rich domain (147-183)
HBV DNA polymerase transactivated serine protease inhibitor
HBVDNAPTP1
HBx
HBZ
HBZ2

HC2
HC11
HC14
HC21
HCA
HCA2
HCA3
HCA57
H-cadherin
HCAM
HCAR2
HCAR3
HCASMC
HCB1-SV40
HCC
Hcc-1
HCC1
HCC2
Hcc-2
HCC3
HCC4
HCC15.1 peptide
HCC15.2 peptide
HCC1[1-74]
HCC1[3-74]
HCC1[4-74]
HCC1[9-74]
Hc-CATH
HCD57
H cells
HCELL
HCF2
hCG
hCG-alpha
hCG-beta
hCG-beta(55-92)
hCG-beta(6-40)
hCGβcf
hCGbetacf
HCGF
hCG free beta
hCG-H
hCG/LH receptor
hCGn
HC-gp39
H-chain-binding protein
HCI
HCII
HCIP
hck
hck-1
HCK cells
HCLS1 associated protein X-1
HCLS-binding protein 1
HCLSBP1
HCMV IL10
HCMV UL36
HCMV UL37
HCMV UL38
HCNP
HCNP-pp
HCNP precursor protein
HCP
HCP-1
HcpA
HCPH
HCR
HCRT
HCRT1
HCRT2
HCRTR1
HCRTR2
HCS
HCS2
Hcs24
HCS-derived suppressor factor
HCSF
HCSf
HCV E2 protein
HCV glycoprotein E2
HCV NS2 protein
HCV NS3 protein
HCV NS4A protein
HCV NS4B protein
HCV NS5A protein
HCV NS5B protein
HCV p7 protein
HCV replicase
HCV RNA-dependent RNA polymerase
HCY2
H-Chymase

HD-5
HD-6
HD6 antigen
HD28
HD39 antigen
HD5(23-94)
HD5(29-94)
HD5(56-94)
HD5(63-94)
HDAC7 7A peptide
HDACs
HDAPs
HDaxx
HD cells
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
HDGC
HDGF
HDGF-2
HDGF-A
HDGF-B
HDGF-C
HDGF-related protein-1
HDGF-related protein-2
HDGF-related protein-3
HDGF-related protein-4
HDGF-related protein-3(33-49)
HDGF-related protein-3(50-68)
HDGFRP2
HDGFRP3
HDGFRP3 (33-49)
HDGFRP3 (50-68)
hdl
HDLF
HDMECs
HDMNKVLDL
HDMs
HDNF
HDNs
Hd-PGRP-1
Hd-PGRP-2
HDPs

HE2
HE2-alpha
HE2-beta
HE2-beta-1
HE2-beta-2
HE2-gamma
HE4
HE5
HEA125
Head activator
Head activator binding protein
head direction cells
head direction neurons
Head involution defective
Head peptide-I
Head peptide-II
Headpin
headturner
Heart cadherin
Heart Chymase
Heart-derived growth factor
Heart derived inhibitor of vascular cell proliferation
heart failure cells
heart, kidney, adipose-enriched transmembrane protein
heart muscle cells
Heart-type fatty acid-binding protein
heartless
HEAT
heat labile serum factor UF
heat shock 10 kDa protein 1
heat shock 27 kDa protein 1
heat shock 27kDa protein 2
heat shock 60 kDa protein 1
heat shock 70kDa protein 1A
heat shock 70kDa protein 1B
Heat shock 70 kDa protein 5
heat shock 70 kDa protein 8
heat shock 70 kDa protein 9
heat shock 70 kDa protein 9B
heat shock 70 kDa protein 10
heat shock 70 kDa protein inducible
heat shock cognate 70 kDa protein
heat shock cognate 71 kDa protein
heat shock cognate 73 kDa protein
heat shock factor 1
Heat shock induced factor
heat shock protein 10
heat shock protein 20
heat shock protein 27
heat shock protein 40
heat shock protein 47
heat shock protein 60
heat shock protein 70
heat shock protein 70 inducible
heat shock protein 71
heat shock protein 72
heat shock protein 73
heat shock protein 75 kDa
heat shock protein 90
heat shock protein 90-alpha
heat shock protein 90-beta
heat shock protein 90kDa alpha class A member 1
heat shock protein 90kDa beta-1
heat shock protein 100
heat shock protein 108
heat shock protein 70-1
heat shock protein 70-2
heat shock protein A8
heat shock protein A10
heat shock protein B6
Heat shock protein beta-1
heat shock protein beta-2
heat shock protein beta-5
Heat shock protein beta-6
heat shock protein family A member 1A
heat shock protein family A member 1B
heat shock protein family E (Hsp10) member 1
heat shock protein GP96
heat shock proteins
heat shock response
heat shock transcription factor 1
heat stable antigen
Heavy chain class switching
HEBP
HEBP1
hebraein
hEBSA
hec2
HECL
HECs
HECT and RLD domain containing E3 ubiquitin protein ligase 5
HECT domain
Hedgehog
Hedgehog-interacting protein
Hedgehog-interacting protein 1
hedgehog interacting protein 2
Hedgehog-interacting protein 3
hedgehog interacting protein-like 1
Hedgehog-interacting protein-like 2
Hedgehogs
heedless
HEF
Hegfl
Heidenhain's cells
HEIR1
HEK
HEK1
HEK2
HEK3
HEK4
HEK5
HEK6
HEK7
HEK8
HEK11
HEK293
HEL-75
HELAD1
HEL chemokine-binding protein
Helgeson phenotype
helical cytokines
Helical factor
Helicard
helicase, APC down-regulated 1
Helicase with 2 CARD domains
Helicobacter cysteine-rich protein A
Helicobacter Cytolethal distending toxin
Helicobacter pylori cell binding protein 2
Helicobacter pylori cheY
Helicobacter pylori cytotoxin-associated gene A
Helicobacter pylori Gamma-glutamyltranspeptidase
Helicobacter pylori gene 0175
Helicobacter pylori gene HP1248
Helicobacter pylori HP0596
Helicobacter pylori HP986 protein
Helicobacter pylori HP1067 protein
Helicobacter pylori HP1118
Helicobacter pylori neutrophil activating protein
Helicobacter pylori ribosomal protein L1
Helicobacter pylori vacuolating cytotoxin A
Helicokinin I
Helicokinin II
Helicokinin III
helicokinins
helicolysins
Helicon cells
Helicostatin-1
Helicostatin-2a
Helicostatin-2b
Helicostatin-3
Helicostatin-4
Helicostatin-5
Helicostatin-6
Helicostatin-7
Helicostatin-8
Helicostatin-9
helicostatins
Heligmosomoides polygyrus TGF-beta mimic
Heliomicin
Helios
helix B-surface peptide
Helix cardioinhibitory peptide
Helix command-specific 2
helix-loop-helix domain
helix-turn-helix motif
Hello Kitty mice
helmet cells
helminth defence molecules
Hel-N1
Hel-N2
Helobdella PAX3 homolog
Helobdella PAX7 homolog
Helobdella robusta engrailed homolog
Helobdella robusta even-skipped homolog
Helobdella robusta Hairy and Enhancer of split homolog
Helobdella robusta nanos homolog
Helobdella robusta notch homolog
helodermin
helospectin
helospectin-1
helospectin-2
helper ILCs
helper/inducer T-cells
helper innate lymphoid cells
helper peak 1
helper T-cells
HELP REQUEST
Hem-1
Hem-2
hemangioblasts
hemangiogenesis
Hemangiopoietin
hematoblasts
hematocytoblasts
hematogones
hematohistioblasts
Hematology Dictionary
hematon
hematopoiesis
Hematopoiesis Dictionary
Hematopoietically expressed homeobox
hematopoietic biglycan
hematopoietic CD44
Hematopoietic cell antigen
hematopoietic cell E-/L-selectin ligand
Hematopoietic cell growth factor
hematopoietic cell kinase
hematopoietic cell kinase-1
Hematopoietic cell phosphatase
hematopoietic cells
Hematopoietic consensus tyrosine-lacking kinase
Hematopoietic colony stimulating factor-309
Hematopoietic cytokines
hematopoietic death receptor
hematopoietic endothelial progenitor cells
hematopoietic EPCs
hematopoietic growth factor inducible neurokinin-1 type
Hematopoietic growth factors
hematopoietic HCELL
Hematopoietic inductive microenvironment
hematopoietic lineage switch gene 7
Hematopoietic neural membrane protein 1
Hematopoietic progenitor cell growth stimulating activity
hematopoietic progenitor cells
hematopoietic protein 1
hematopoietic protein 2
hematopoietic SH2 domain containing
hematopoietic SH2 protein
Hematopoietic Signal peptide-containing Membrane domain-containing 1
Hematopoietic Signal peptide-containing Secreted 1
Hematopoietic-specific transmembrane protein 4
hematopoietic stem and progenitor cells
hematopoietic stem cell antigen
hematopoietic stem cell chemotactic factor
hematopoietic stem cell niche
hematopoietic stem cells
hematopoietic stem cells/hematopoietic progenitor cells
hematopoietic stem progenitor cells
hematopoietic stem/progenitor cells
Hematopoietic synergistic factor
Hematopoietin-1
Hematopoietin-2
Hematopoietin receptor superfamily
Hematopoietins
HEMbeta111-146
HEMCAM
heme-binding protein
heme-binding protein-1
heme-binding protein 23 kDa
Hemicentin 1
hemi-immunoreceptor tyrosine-based activation motif
HemITAMs
hemoblasts
Hemochromatosis 2
Hemochromatosis 3
hemocidins
hemocyte chemotactic peptide
hemocytes
hemocytoblasts
Hemofiltrate CC-Chemokine-1
Hemofiltrate CC-Chemokine-2
Hemofiltrate CC-Chemokine-3
Hemofiltrate CC-Chemokine-4
hemogenic endothelial cells
hemogenic endothelium
Hemoglobin
Hemoglobin A2
hemoglobin-alpha
Hemoglobin-alpha-1
Hemoglobin-alpha-2
hemoglobin-alpha(1-11)
hemoglobin-alpha(1-29)
hemoglobin-alpha(1-30)
hemoglobin-alpha(1-31)
hemoglobin-alpha(1-32)
hemoglobin-alpha(1-33)
hemoglobin-alpha(3-19)
hemoglobin-alpha(32-93)
hemoglobin-alpha(33-38)
hemoglobin-alpha(33-46)
hemoglobin-alpha(33-61)
hemoglobin-alpha(33-61a)
hemoglobin-alpha(34-68)
hemoglobin-alpha(71-84)
hemoglobin-alpha(88-112)
Hemoglobin-alpha(97-114)
hemoglobin-alpha(106-141)
hemoglobin-alpha(107-136)
hemoglobin-alpha(107-141)
hemoglobin-alpha(110-125)
hemoglobin-alpha(110-141)
hemoglobin-alpha(129-134)
hemoglobin-alpha(133-138)
hemoglobin-alpha(133-141)
hemoglobin-alpha(134-140)
hemoglobin-alpha(134-141)
hemoglobin-alpha(135-141)
hemoglobin-alpha(137-138)
hemoglobin-alpha(137-141)
hemoglobin-alpha-1(95-103)
hemoglobin anti-HIV peptide-25
Hemoglobin-associated macrophages
hemoglobin-beta
Hemoglobin-beta(1-10)
hemoglobin-beta(1-29)
hemoglobin-beta(1-30)
hemoglobin-beta(1-33)
hemoglobin-beta(1-41)
hemoglobin-beta(31-36)
hemoglobin-beta(32-39)
hemoglobin-beta(32-40)
hemoglobin-beta(32-41)
Hemoglobin-beta(33-37)
hemoglobin-beta(33-38)
hemoglobin-beta(33-41)
hemoglobin-beta(33-95)
hemoglobin-beta(35-41)
hemoglobin-beta(99-110)
hemoglobin-beta(111-146)
hemoglobin-beta(115-146)
hemoglobin-beta(126-145)
Hemoglobin-delta
Hemoglobin-epsilon
hemoglobin-epsilon-1
Hemoglobin F
Hemoglobin gamma-1
Hemoglobin gamma-2
Hemoglobin gamma-A
Hemoglobin gamma-G
Hemoglobin Gower 1
Hemoglobin Gower 2
hemoglobin/haptoglobin scavenger receptor
hemoglobin microbicidal peptides
hemoglobin P1 peptide
hemoglobin P2 peptide
hemoglobin P3 fragment
hemoglobin P3 peptide
Hemoglobin Portland-1
Hemoglobin Portland 2
hemoglobin scavenger receptor
hemoglobin-stimulated macrophages
hemoglobin-zeta
hemoglobin-zeta-2
hemohistioblasts
hemojuvelin
Hemokinin-1
Hemolin
Hemolymphopoietic growth factor-1
hemolysin 2
hemolysin BL
Hemopexin
hemopexin domains
hemopexin-like domains
hemopexin-type repeats
hemophagocytic lymphohistiocytosis 2
Hemopoietic Cell Adhesion Molecule
Hemopoietic cell growth factor
hemopoietic cell kinase
hemopoietic cells
hemopoietic lineage switch 5
hemopoietic progenitor cell antigen 1
hemopoietic stem cells
Hemopoietin-1
Hemopoietin-2
Hemopressin
Hemopressin-alpha
Hemoregulatory peptide
Hemoregulatory peptide 5
Hemoregulatory peptide 5b
Hemorphin-4
Hemorphin-5
Hemorphin-7
hemorphins
hemorrhage-associated macrophages
hemorrhage-specialist macrophages
Hemorrhagic factor
hemorrhagic toxin d
hemorrhagins
Hendra virus V protein
Henle cells
Hensen's cells
Hensin
HEP
Hep-20
Hep-25
HEP64
Heparan sulfate proteoglycan core protein
Heparan sulfate proteoglycan core protein-1
Heparan sulfate proteoglycans
heparan sulfate proteoglycan M13
hepar-derived netrin-like protein
HepaRG
Heparin affin regulatory peptide
Heparin binding brain mitogen
heparin binding domain
Heparin binding EGF
Heparin binding EGF-like factor
Heparin binding EGF-like factor C
Heparin binding EGF-like growth factor
Heparin binding growth-associated factor
Heparin binding growth-associated molecule
heparin binding growth factor 0.8
heparin binding growth factor 0.8-P1
heparin binding growth factor 0.8-P2
Heparin binding growth factor-1
Heparin binding growth factor-1U
Heparin binding growth factor-2
Heparin binding growth factor-3
Heparin binding growth factor-4
Heparin binding growth factor-5
Heparin binding growth factor-6
Heparin binding growth factor-7
Heparin binding growth factor-8
Heparin binding growth factor-9
Heparin binding growth factor-alpha
Heparin binding growth factor-beta
heparin-binding growth factor-binding protein 17 kDa
heparin binding growth factor family
Heparin binding growth factors
Heparin binding neurite-promoting factor
Heparin binding neurotrophic factor
heparin binding protein
Heparin-binding protein HBp15
Heparin binding secretory transforming factor-1
heparin-binding secretory transforming gene
Heparin cofactor 2
heparin cofactor 2 (49-60)
Heparin neutralizing protein
Heparin-Sepharose affinity chromatography
Hepassocin
hepatic erythropoietic factor
hepatic fibrinogen/angiopoietin-related protein
Hepatic lipocytes
hepatic macrophages
hepatic parenchymal cells
hepatic pit cells
hepatic progenitor cells
hepatic regenerative stimulation substance
Hepatic sinusoidal endothelial cell-derived migration stimulating factor
hepatic sinusoidal endothelial cells
hepatic stellate cells
Hepatic stimulator substance
hepatitis A virus cellular receptor
hepatitis A virus cellular receptor 1
hepatitis A virus cellular receptor 2
hepatitis B virus core protein
Hepatitis B virus core protein arginine-rich domain (147-183)
Hepatitis B virus DNA polymerase transactivated serine protease inhibitor
hepatitis B virus HBx protein
Hepatitis C virus E2 protein
hepatitis C virus nonstructural protein 2
Hepatitis C virus nonstructural protein 3
Hepatitis C virus nonstructural protein 4A
Hepatitis C virus nonstructural protein 4B
Hepatitis C virus nonstructural protein 5A
Hepatitis C virus nonstructural protein 5B
hepatitis C virus NS2 protein
Hepatitis C virus NS3 protein
Hepatitis C virus NS4A protein
Hepatitis C virus NS4B protein
Hepatitis C virus NS5A protein
Hepatitis C virus NS5B protein
Hepatitis C virus p7 protein
hepatoblast-like cells
hepatoblasts
hepatocarcinoma
hepatocarcinoma cells
hepatocellular carcinoma
hepatocellular carcinoma 1
hepatocellular carcinoma-associated antigen 57
hepatocellular carcinoma-intestine-pancreas
hepatocyte-derived fibrinogen-related protein 1
Hepatocyte growth factor
hepatocyte growth factor-1/macrophage stimulating protein
Hepatocyte growth factor activator
Hepatocyte growth factor activator inhibitor
Hepatocyte growth factor activator inhibitor-1
Hepatocyte growth factor activator inhibitor-2
hepatocyte growth factor activator inhibitor-2-related small peptide
Hepatocyte growth factor-like protein
hepatocyte growth factor receptor
Hepatocyte growth factor-scatter factor
Hepatocyte growth inhibitory factor
Hepatocyte growth stimulating factor
Hepatocyte proliferation factor
Hepatocyte proliferation factor-1
Hepatocyte proliferation factor-2
Hepatocyte proliferation inhibitor
hepatocytes
Hepatocyte stimulating factor
Hepatocyte stimulating factor-1
Hepatocyte stimulating factor-2
Hepatocyte stimulating factor-3
Hepatocyte stimulator peptide
hepatokine
hepatoma cells
Hepatoma-derived growth factor
Hepatoma-derived growth factor-2
Hepatoma-derived growth factor-A
Hepatoma-derived growth factor-B
Hepatoma-derived growth factor-C
Hepatoma-derived growth factor-related protein 2
Hepatoma-derived growth factor-related protein 3
Hepatoma-derived growth factor-related protein 3(33-49)
Hepatoma-derived growth factor-related protein 3(50-68)
Hepatoma growth factor
hepatoma subtracted-cDNA library clone one
hepatoma transmembrane kinase
Hepatopoietin
Hepatopoietin A
Hepatopoietin B
hepatopoietin Cn
hepatospheres
hepatotrophin
Hepatotropin
HEPC
Hepc1
Hepc2
Hepc20
Hepc25
Hepcidin
Hepcidin-1
Hepcidin-2
hepcidin-20
hepcidin-22
hepcidin-25
Hepcidin antimicrobial peptide
Hepcidin antimicrobial peptide-1
Hepcidin antimicrobial peptide-2
hepcidin JF1
hepcidin JF2
HEP-COP
HepG2
HEP I
HEP II
Hep-JF1
Hep-JF2
Hepsin
HER1
HER2
HER2-ECD
HER3
HER4
Herbimycin A
HERC5
HERC6
Herceptin
hereditary angioedema type 1
hereditary angioedema type 2
hereditary hemorrhagic telangiectasia type 1
Hereditary Hemorrhagic Telangiectasia Type 2
hereditary persistence of alpha-fetoprotein
Heregulin
heregulin-1
heregulin-2
heregulin-2-alpha
heregulin-2-beta
heregulin-3
heregulin-4
Heregulin-alpha
Heregulin-beta-1
Heregulin-beta-2
Heregulin-beta-3
Heregulin-gamma
Herfin-1
Hermes antigen
Hermes-1
hernocytoblasts
herpes simplex virus 1 gamma34.5 protein
Herpes simplex virus 1 glycoprotein G
Herpes simplex virus 1 UL49
Herpes simplex virus 1 US4 protein
Herpes simplex virus 1 US5 protein
Herpes simplex virus 1 VP22 protein
Herpes simplex virus 2 dUTPase
Herpes simplex virus 2 glycoprotein B
Herpes simplex virus 2 glycoprotein G
Herpes simplex virus 2 growth factor
Herpes simplex virus 2 UL50 protein
Herpes simplex virus 2 US4 protein
Herpes simplex virus ICP34.5 protein
Herpesvirus-6A dUTPase
Herpesvirus-6A U45 protein
Herpesvirus-6A U83 protein
Herpesvirus-6B U83 protein
Herpesvirus 6 U12 protein
Herpesvirus 6 U51 protein
Herpesvirus saimiri IL17
Herpes simplex virus alpha22 protein
Herpes simplex virus entry protein A
Herpes simplex virus entry protein B
Herpes simplex virus entry protein C
Herpes simplex virus gJ protein
Herpes simplex virus glycoprotein J
Herpes simplex virus ICP0 protein
Herpes simplex virus ICP6 protein
Herpes simplex virus ICP10 protein
Herpes simplex virus ICP22
Herpes simplex virus ICP27 protein
Herpes simplex virus ICP34.5
Herpes simplex virus IE110 protein
Herpes simplex virus infected cell protein 22
Herpes simplex virus RL1 protein
Herpes simplex virus type 1 UL39 protein
Herpes simplex virus type 2 ICP10PK protein
herpes simplex virus type 2 R1 protein kinase
Herpes simplex virus type 2 ribonucleoside-diphosphate reductase
Herpes simplex virus type 2 ribonucleotide reductase
Herpes simplex virus type 2 UL39 protein
Herpes simplex virus UL49 protein
Herpes simplex virus US3 protein
Herpes simplex virus US4 protein
Herpes simplex virus US5 protein
Herpes simplex virus VP22 protein
herpesvirus 68 BCL2
herpesvirus 68 ORF 74
herpesvirus 68 RTA
herpesvirus chemokine binding protein
Herpesvirus entry mediator
Herpesvirus entry mediator A
Herpesvirus entry mediator B
Herpesvirus entry mediator C
Herpesvirus entry mediator D
Herpesvirus entry mediator ligand
Herpesvirus glycoprotein D
Herpesvirus Ig-like receptor
Herpesvirus KSHV orf74
herpesvirus papio IL10
Herpesvirus saimiri BCL2
Herpesvirus saimiri ECRF-3
Herpesvirus saimiri HVS13
herpesvirus type 6 H83 protein
herpesvirus type 6 U12 protein
herpesvirus type 6A U12 protein
herpesvirus type 6B U12 protein
herpesvirus type 6 U51 protein
herpesvirus type 6 U83A protein
herpesvirus type 7 U12 protein
herpesvirus type 8 K2 protein
HERS cells
HERS/ERM cells
Herstatin
Hertwig’s epithelial root sheath cells
Hertwig’s root sheath cells
HERV1
HERV-H LTR-associating protein 2
Hespintor
HESS-5
hEST2
heterogeneous nuclear ribonucleoprotein A1
heterogeneous nuclear ribonucleoprotein C
heterogeneous nuclear ribonucleoprotein C1/C2
heterogeneous nuclear ribonucleoprotein D
heterogeneous ribonucleoprotein A18
heterologous gene expression
heterophilic
heterophils
heterophilic granulocytes
Heteroscorpine-1
heterotypic
heterotypic cell-in-cell death
Hetrin
Heuchera sanginea antifungal peptide-1
HevC
HEV cells
Hevin
HEVs
HEX
hexabrachion
hexafin-1
hexafin-2
hexafin-3
hexafin-8
hexafin-9
hexafin-10
hexafin-17
hexafins
hexamerins
Hexastatin-1
Hexastatin-2
Hexastatin-3
Hexastatins
hexosephosphate isomerase
Heymann nephritis antigen

Hf
HF
HF1
H-FABP
H factor
H factor-1
HFARP
HFB-1
hFcRI
hFcRII
hFcRIII
hFDGI
HFE2
HFE3
H-Ferritin
hFGF
hFGF family
HFHHALPPARHHPDLEAQARRAQEEADAEERRRQEQEELENYIEHVLLHRP
H-ficolin
HFKDPKRLYCK
HFREP1
HFREP-1/LFIRE-1
HFSP
HFZ5
HFZ6

HG1peptide
HG11
HG38
Hga
HGb
hGC-1
HGE-derived stimulatory factor
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HGF
HGF1
HGF1/MST
HGFA
HGFAC
HGF activator
HGF activator inhibitor
HGF activator inhibitor type 1
HGF activator inhibitor type 1A
HGF activator inhibitor type 1B
HGF activator inhibitor type 2
HGFA inhibitor-1
HGFA inhibitor-2
HGF-alpha
HGF-beta
HGFIN
HGFL
HGFLP
HGF-like protein
HGF/NK1
HGF/NK2
HGF/NK4
HGFR
HGF receptor
HGFs
HGF/SF
hGH-L1
hGH-L2
HGH-V protein
HGI
HGIVVGTCPLGYTRRGGFCFQDDDY
hGK-1
HGK2
HGL
HGLDNYR
HGP43
HGP92
HGPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
hGR3
HGR74
HGSF
HGT
HGTD-P
HGVSGHGQHGVHG
hGW2052

Hh
HH2
HH4R
HHA
H-hCG
Hhg-1
Hhg-2
Hhg-3
HHHHHHHHHHHHHHHH
HHIP
HHIP1
HHIP2
HHIP3
HHIPL1
HHIPL2
HHIP-like protein 1
HHLA2
HHs
HHT1
HHT2
HHV-6 U12
HHV-6A U12
HHV-6B U12
HHV-7 U12
HHV-8
HHV-8 BCK protein
HHV-8 BCL2 protein
HHV-8 dUTPase
HHV-8-FLIP
HHV-8 GPCR
HHV-8 K6 protein
HHV-8 K12 protein
HHV-8 K4.1 protein
HHV-8 K4.2 protein
HHV-8 kaposin
HHV-8 K-bZIP
HHV-8 LANA
HHV-8 latency-associated nuclear antigen
HHV-8 Lyta
HHV-8 MTA
HHV-8 orf4
HHV-8 orf5
HHV-8 orf16
HHV-8 orf45
HHV-8 orf50
HHV-8 orf54 protein
HHV-8 orf57
HHV-8 orf63
HHV-8 orf71
HHV-8 orf74
HHV-8 orfK1
HHV-8 orfK2
HHV-8 orfK4
HHV-8 orfK5
HHV-8 orfK6
HHV-8 orfK7
HHV-8 orfK9
HHV-8 orfK12
HHV-8 orfK13
HHV-8 orfK14
HHV-8 orfK15
HHV-8 orfK4.1
HHV-8 orfK10.5
HHV-8 OX2
HHV-8 RTA
HHV-8 viral IL6
HHV-8 viral MIP-1-alpha
HHV-8 viral MIP-2

HI-30
Hi95
HIAF-1
HIAP1
HIAP2
HIAR
HIB-1B
HIBECs
HICAP cells
Hid
hidden cytokines
HIF-1 alpha-responsive pro-apoptotic molecule
HIF-prolyl hydroxylase 2
high affinity calcium-binding protein
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
High affinity immunoglobulin epsilon receptor subunit beta
High-affinity levocabastine-insensitive neurotensin receptor
high cell density-enhanced PTP-1
high density neutrophils
High endothelial cells
High endothelial venule cells
High endothelial venule endothelial cells
high endothelial venules
high-firing neurons
high-grade transformation
high in normal-1
high in normal-2
highly homologous peptide 2
High mobility group A2
High mobility group AT hook 2
high mobility group box-1
high mobility group box 2
high mobility group box-3
high mobility group nucleosomal binding protein 1
high mobility group nucleosomal binding protein 2
high mobility group protein-1
high mobility group protein 1-like-2
high mobility group protein 2
high mobility group protein-2A
high mobility group protein-4
high mobility group protein 14
high mobility group protein 17
High mobility group protein A2
high mobility group protein IC
High molecular mass inhibitor factor
High molecular weight B-cell growth factor
High molecular weight kininogen
high molecular weight kininogen domain 5
high molecular weight-melanoma-associated antigen
high molecular weight renin
High proliferative potential colony-forming cells
High proliferative potential-quiescent cells
high sensitivity CRP
high-temperature requirement factor A
high-temperature requirement factor A1
high-temperature requirement factor A2
high transport band-3
HIGM1
HIgR
HI horizontal cells
HII horizontal cells
HIL-3-derived factor
H-IL6
hilar mossy cells
HILDA
hILP
hILP interacting protein
HIM
Himanturin
HIMS-defensin
HIMECs
HIMF
HIN-1
HIN-2
HIN-200 domain
HIN-200 family
HIN domain
HIN family
Hinnavin-1
Hinnavin-2
Hinnavins
HINT2
HIP
Hip-1 protein interactor
HipC
hipertensina
Hipes-AKH-III
HIP/PAP
Hippi
hippo
hippocampal cholinergic neurostimulating peptide
Hippocampal type-2 cells
Hippocampus-derived neurotrophic factor
Hippocampus kuda Bleeker pleurocidin-like peptide
hipposin
Hipposin (1-19)
Hipposin (1-36)
Hipposin (1-39)
Hipposin (16-36)
Hipposin C-terminal fragment
hIRH
HIRL
Hirschsprung disease 1
Hirtenzellen
hirudin-binding protein
HIS1
HIS2
His4-Gln7-Corazonin
His5Trp7Tyr8-GNRH
His5Trp7Tyr8-GNRH1
His7-Corazonin
HIS50
His1-(31-57)-peptide
His3-(20-43)-peptide
His3-(20-44)-peptide
His3-(24-30)-peptide
His3-(24-31)-peptide
His3-(31-43)-peptide
His3-(31-44)-peptide
His3-(31-51)-peptide
His3-(32-43)-peptide
His3-(32-44)-peptide
His-D-Trp-Ala-Trp-D-Phe-Lysamide
His-Gly-Leu-Asp-Asn-Tyr-Arg
His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly
HISHISMCRWCCNCCKAKGCGPCCKF
His-Ile-Arg-Leu
HISL-19
His-Leu-Pro-Leu-Pro
His-Lys-Glu-Met-Pro-Phe-Pro-Lys
His-Pro-His-Pro-His-Leu-Ser-Phe
His-Pro-Lys-Arg-Pro-Trp-Ile-Leu
His-Purkinje cells
HisRS
HISSF
Hist1h1a
Hist1h1b
Histamine induced suppressor factor
histaminergic neurons
Histamine neurons
Histamine-producing cell stimulating factor
histamine-production-increasing factor
histamine receptor H4
histamine receptor type 4
Histamine release blocking factor
Histamine release inhibitory factor
Histamine releasing factors
Histamine-releasing peptide
histatin-1
histatin-2
histatin-3
histatin-4
histatin-5
histatin-6
histatin-7
histatin-8
histatin-9
histatin-10
histatin-11
histatin-12
Histatins
Histidine-proline-rich glycoprotein
histidine-rich glycoprotein
histidine-rich polypeptide-1
histidine-rich polypeptide-2
histidine-rich polypeptide-3
histidine-rich polypeptide-4
histidine-rich polypeptide-5
histidine-rich polypeptide-6
histidine-rich protein-1
histidine-rich protein-2
histidine-rich protein-3
histidine-rich protein-4
histidine-rich protein-5
histidine-rich protein-6
histidine-rich protein-7
histidine-rich protein-8
histidine-rich protein-9
histidine-rich protein-10
histidine-rich protein-11
histidine-rich protein-12
histidine triad nucleotide binding protein
Histidine-tRNA Ligase
Histidyl-tRNA synthetase
Histin
histiocytes
Histiocyte-secreted-factor
Histiocytic Emperipolesis
histiomonocytes
histoblasts
histo-blood group antigens
histocompatibility 2 M region locus 3
histocompatibility dependent on a maternally transmitted factor
Histoglobin
Histogranin
Histolysocytes
histone acetyltransferases
Histone-arginine N-methyltransferase PRMT5
Histone deacetylase 7 7A peptide
histone deacetylases
histone demethylases
Histone-derived antimicrobial peptides
histone-derived fragment-1
Histone H1
histone H1 targeting peptide
Histone H1.1
Histone H1.5
histone H1(2-38)
histone H2A
Histone H2A(1-19)
Histone H2A(1-35)
Histone H2A(1-40)
Histone H2A(1-44)
Histone H2A(1-49)
Histone H2A(1-50)
Histone H2A(1-51)
Histone H2A(62-85)
Histone H2AX
histone H2B
histone H3
Histone H4
histone H4(90-103)
histone H5(61-90)
histone H4(86-100)
histone H4(89-102)
histone-like protein-1
histone-like protein-3
histone methyltransferases
histone synthetic lethal 7
HIV1 gp41
HIV1 gp120
HIV1 gp120 F peptide
HIV1 gp120 V3 peptide
HIV1 gp41(638-673)
HIV1-inhibitory factor
HIV-1 matrix protein p17
HIV1 Nef protein
HIV-1 p17 protein
HIV1 protein U
HIV1 resistance factor
HIV1 Rev protein
HIV1 Rev(34-50)
HIV1 TAR RNA-binding protein B
HIV1 tat protein
HIV1 Vpr
HIV1 Vpu protein
HIV gp120 binding protein
HIVsuppressive factors
HIV tat protein
HIV Transactivator of Transcription
HIV Vpr protein
hiwi

HJ1
HJV

HK
HK-1
hK2
hK4
hK5
hK8
hK13
HKa
Hkat
HKB-1
HKEMPFPK
HKH17
HKH20
HKHGHGHGKHKNKGKKN
HKHGHGHGKHKNKGKKNGKH
HKLRVDPVNFKLLSH
HKNKGKKNGKHNGWKT
HKP1
HKP9
HKPLP
HKPs
HKTDSFVGLMamide

HL-1
HL-2
HL9
HL14
HL-60
HL-60-derived apoptosis inducing factor
HL-60 differentiation factor
HL-60-HGF
HL-60 maturation inducer
HLA-6.0
HLA60
HLA-B-associated transcript 3
HLA class II histocompatibility antigen gamma chain
HLADG
HLA-DR antigens-associated invariant chain
HLA-DR-gamma
HLA-G
HLA-G1
HLA-G2
HLA-G3
HLA-G4
HLA-G5
HLA-G6
HLA-G7
HLBI
HLBP14
HLD4
HLDF
HlgAB
HlgCB
HLGF-1
Hlgut-Defensin
HLH 1R21
HLH2
HLH462
HLH domain
HLI-alpha
HLIPFPRVamide
HLNILSTLWKYRC
HLP
HLP-1
HLP-3
HLPLP
HLS5
HLS7
Hlsal-Defensin
HLT1
HLT2
HLWAR77
hly9
HlyII

Hm
HM1-SV40
HM2-SV40
HM18
HM31
HM43
HM43/HM31
HM63
HM74
HM74A
HM74B
HM89
HM1.24 antigen
HM145
HM48-1
HMAT1
HMC-1 cells
HMC-1.1
HMC-1.2
HMC-1 5C6
HMCN1
HME
HMECs
HMFG antigen
hMG
HMG-1
HMG1L2
HMG2
HMG2A
HMG4
HMG14
HMG17
HMG2(17-48)
HMG17[69-89]
HMGA2
HMGA2/T
HMGB1
HMGB2
HMGB3
HMG box
HMGF
HMGF-1
HMGF-2
HMGF-3
HMGIC
HMGN1
HMGN2
HMGN2(17-48)
HMGN2[69-89]
H-miRNAs
HML
HML1
HML2
HMMIF
HMMR
HMP
HMPV SH protein
HMPV small hydrophobic protein
HMRP-2A
HMRP-2B
Hmt
HMTs
HMW-BCGF
HMWK
HMWKa
HMWK-kallikrein factor
HMW kininogen
HMW-MAA
HMW renin

HN
HNA1
HNA1a
HNA1b
HNA1c
HNA2A
HNA4a
HNA5a
HNGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT
HNK-1
HNKQEGRDHDKSKGHFHRVVIHHKGGKAH
HNKQEGRDHDKSKGHFHRVVIHHKGGKAHRG
HNL
HNMP-1
HNP-1
HNP-2
HNP-3
HNP-4
HNRNPA1
hnRNP A18
HNRNPC
hnRNP C1/C2
HNRNPD
hnRNP K homology domain
HNT
HnudC

Ho342
Hoa-crustin
hob
hobble
Hodgkin and Reed-Sternberg cells
Hodgkin-derived leukocyte factor
Hodgkin's cell growth factor
Hoechst 33342
Hoechst-effluxing cells
Hoechst H33342
Hofbauer cells
hOLF44
Holley antigen
holoclone-forming cells
holoclones
Holocrine glands
Holotrichia diomphalia PGRP
holotrichous isorhizas
holotricin-1
holotricin-2
holotricin-3
holotricins
Homarin
Homarus americanus Anti-lipopolysaccharide factor 1
Homarus americanus Anti-lipopolysaccharide factor 2
Homarus americanus sulfakinins
Homeo box
Homeo domain
homeostatic chemokines
homeostatic memory T-cells
homeostatic thymus hormone
homeostatic thymus hormone-alpha
homeostatic thymus hormone-beta
Homeotic genes
HOM-HD-21
homing-associated cell adhesion molecule
homing peptides
Hominicin
homocysteine-induced gene 2
homolog
homolog of ASY protein
Homolog of erv-1
homolog of quaking
homologous recombination
homologous restriction factor-20 kDa
homologous to the amino terminus of HDGF
homophilic
homo sapiens pluripotent embryonic stem cell-related gene
homotypic
homotypic cell-in-cell death
hookworm platelet inhibitor
Hop
HOP-26
hoplocytes
horizontal cells
Horizontal basal cells
horizontal cells of Cajal
horizontal cells of Cajal-Retzius
horizontals
hormonal miRNAs
hormone-like FGFs
hormone-like fibroblast growth factors
hormones
Hormones Dictionary
hormones/neuropeptide dictionary
horn cells
Hornerin
horny cells
Horst Ibelgaufts
Hortega cells
hortus siccus
Hospicells
host defence macrophages
Host defence peptides Dictionary
host defense peptides
host defense peptides dictionary
house-keeping cytokines
Howard Young
How to write a scientific paper
HOX

Hp
HP
HP0175
HP0596
HP1
HP-1
hP1.B
HP1-SMP
HP-2
HP2
HP-3
HP3-SMP
HP-4
HP5
HP5b
Hp(1-9)
Hp(2-13)
HP (2-20)
Hp(2-38)
HP (4-16)
HP986
HP1067
HP1118
HP1248
Hp1404
HP10390
HPA
HPA-1
HPA-1a
HPA-1b
HPA-2
HPA-2a
HPA-2b
HPA-3
HPA-3a
HPA-3b
HPA-4
HPA-4a
HPA-4b
HPA-5
HPA-5a
HPA-5b
HPA-15
HPA-15a
HPA-15b
HPAEC survival factor
HPAFP
HP-alpha
HP-alpha-1
HP-alpha-2
HP-alpha 1-1
HP-alpha 2-2
HPASMC
HP-beta
Hp-beta(99-110)
HPC
HPC-1
HPCA1
HPESCRG1
HPF
HPF-1
HPF-2
hpg
HPGF
HP-GSA
HPH2
HPHPHLSF
HP/HS interacting protein
HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR
HPI
HPIF
HPKRPWIL
HPKRWIL
HPLC-P-1
HPLH2
HPN
HP-NAP
hpo
HPO
HPO23
HPO-205
hp0211
HPP1
hPP3 peptide
hPP10 peptide
HPP-BFU-E
HPP-CFC
HPP-CFC-1
HPP-CFC-2
HPP-CFC-3
HPPCn
HPPF
HPP-G
HPP-GEMM
HPP-GM
HPP-M
HPP-Mix
HPP-Q
HPP-Q BFU-E
HPP-Q G
HPP-Q GEMM
HPP-Q GM
HPP-Q M
HPP-Q Mix
hppy
HPR1
HPRG
HPSTI
HPTA
HPTB
Hp-TGM
HPTP-eta
HPV16 E5 protein
HPV E2 protein
HPX
Hpxn

Hq
HQ-34 peptide
HQK

HRA-N
HRAS2
HRASP
HRF
HRF20
hRFI
HRG
HRG-1
HRG1
HRG2
HRG2-alpha
HRG2-beta
HRG3
HRG4
HRGA
HRG-alpha
HRG-beta-1
HRG-beta-2
HRG-beta-3
HRG-gamma
HRGP
HRGP330
HRH2
HRH4
HRHQGPIFDTRPSPFNPNQPRPGPIY
HRHTKQRHTALH
HRIF
Hrk
HRKKHHGKRNSNRAHQGKHETYGHKTPY
H-RN
HRNLFQVDDPFFATRamide
HRNR
H-Robo-1
Hro-eve
Hro-hes
Hro-nos
Hro-notch
HRP
HRP-1
HRP-2
HRP-3
HRP-4
HRP-5
HRP-6
HRP-3(33-49)
HRP-3(50-68)
Hrs-binding protein
HRS cells
HRSV SH protein
HRSV small hydrophobic protein
HrtA2
Hrt-2
HrTH

HS
HS1-associated protein X-1
HS1-binding protein 1
HS1BP-1
HS5 cells
HS27a cells
HSA
HSAC
Hs-AFP1
HSAL4
HSAS
HSAS1
HSB
HSC
HSC70
Hsc70/Hsp90-organizing protein
HSC71
HSC73
HSC/HPC
HSCO
HSCR1
hsCRP
HSD26
HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
HSDAVFTDNYTRLRKQMAVKKYLNSILNamide
HSDF-1
HSDGIFTDSYSRYRKQMAVKKYLAAVLamide
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKamide
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HSDGTFTSELSRLREGARLQRLLQGLVamide
HSECs
hSef
H-sema E
Hsema-I
H-Sema K1
H-Sema-L
HSE-MSF
HSF
HSF1
HSF-1
HSF-2
HSF-3
HSF Elastase
HSFVamides
HSG
HSG cells
HSGc
HSGF-2
HSGFLLAWSGPRNRFVRFamide
HSG-S8
HSGSLDLDALMNRYEPFVPNRamide
HSH2
HSH2D
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
HSHRDFQPVLHLVALNSPLSGGMRG
HSIF
HSL7
HSM1
H-SN1
HSP
HSP1BP-1
hsp10
HSP-12
Hsp20
hsp27
hsp27a
hsp27b
hsp27c
hsp40
hsp47
hsp60
hsp70
HSP70i
hsp72
HSP73
HSP70-1
HSP70-2
hsp10(120)
Hsp70(241-258)
hsp70/hsc70-associating protein
Hsp70/Hsp90-organizing protein
hsp75
HSP89-alpha
HSP89-beta
hsp90
HSP90AA1
hsp90-alpha
HSP90B1
hsp90-beta
HSP90L
hsp90-like protein
hsp100
hsp108
Hsp20(71-91)
Hsp27(93-113)
HSPA1A
HSPA1B
HSPA5
HSPA8
HSPA9
HSPA9B
HSPA10
HSPABP2
HSPB1
HSPB2
hspB5
HSPB6
Hsp/c70
HSPCs
HSPC1
HSPC132
HSPC190
HSPC217
HSPCA
HSPD1
HSPE1
HSPG
HSPG1
HSPG M13
HSpin1
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
HSR
HSS
HSS1
hst
hst-1
Hst 1
hst-1-related
hst-2
Hst 2
Hst 3
Hst 5
Hst 8
HSTF1
HSTF-1
HSV-1-dependent apoptosis
HSV-1 gamma34.5 protein
HSV-1 glycoprotein G
HSV-1 ICP27
HSV-1 infected cell protein 27
HSV-1 UL49
HSV-1 US4 protein
HSV-1 US5 protein
HSV-1 VP22 protein
HSV-2 glycoprotein B
HSV-2 glycoprotein G
HSV-2 growth factor
HSV-2 ICP27
HSV-2 infected cell protein 27
HSV-2 US4 protein
HSV-6A dUTPase
HSV-6A U45 protein
HSVECs

HT
HT-2
HT7
HT29-IGFBP
HT29 insulin-like growth factor binding protein
HT55
HT115
HTA1
hTAP-3
hTAP-4
HTB-9
HTbd3
HTCA
H/T-cadherin
HT-d
ht-en
hTERC
hTERT
hTERT(611-626)
HTH
HTH alpha
HTH beta
HTH motif
HTK
HTKL
HTK ligand
Htl
HTLCMDGGATY
HTLV-1 p13 protein
HTLV-1 P13 II protein
HTLV-I p30
HTm4
HTMYYHHYQHHL
HTN1
HTN2
HTN3
hTR
HtrA
HtrA1
HtrA2
H(+) transporting lysosomal ATPase V0 subunit A2
HTRA serine peptidase 1
HTRA serine peptidase 2
Htu

hu
HuA
HUAF
Hu antigen A
Hu antigen B
Hu antigen C
Hu antigen D
Hu antigen R
Hu antigens
HUASMC
HuB
hub cells
hub neurons
HuC
Hucolin
HuD
Huerthle cells
HUFI-1
hug
HuGC-OOHIRA
Hughes blood group antigen
hugin
hugin-gamma
hugin-PK
Hugin-pyrokinins
HUGL
HUGL1
HuLy-m1
HuLy-m2
HuLy-m3
HuLy-m4
HuLy-m5
human 14 kDa laminin binding protein
Human adipocyte lipid-binding protein
Human Alzheimer’s microglia
human airway smooth muscle cells
human alpha-lactalbumin made lethal to tumor cells
human angiogenic factor
Human antigen R
human aorta endothelial cells
human aortic smooth muscle cells
human apurinic endonuclease 1
human bladder protein
human bladder smooth muscle cells
human brain microvascular endothelial cells
human chemokine receptor
human chorionic gonadotropin
human chorionic gonadotropin-alpha
human chorionic gonadotropin-beta
human cold-induced sweating syndrome
human collagenase inhibitor
human coronary artery smooth muscle cells
Human cytomegalovirus UL36 protein
Human cytomegalovirus UL37 protein
Human cytomegalovirus UL38 protein
human dermal microvascular endothelial cells
human-desmoglein-colon
human EGF receptor-1
human EGF receptor-2
human EGF receptor-3
human EGF receptor-4
human elav-like neuronal protein 1
human embryo kinase-1
human embryo kinase-2
human embryo kinase-3
human embryo kinase-4
human embryo kinase-5
human embryo kinase-6
human embryo kinase-7
human embryo kinase-8
human embryo kinase-11
human emc and Id related
Human endogenous retrovirus-H long terminal repeat-associating protein 2
human epididymis 4
human epididymis secretory protein-2
human epididymis secretory protein-5
human erythroid burst stimulating activity
Human fibrinogen-related protein-1/liver fibrinogen-related protein-1
human fibroblast-derived growth inhibitor
human glioma-derived T-cell suppressor factor
human growth hormone-like-1
human growth hormone-like-2
human herpesvirus-8 orf57
human herpesvirus type 8
Human herpesvirus type 8 dUTPase
human herpesvirus type 8 FLICE-inhibitory protein
Human herpesvirus type 8 orf54 protein
human IAP-like protein
human IAP-like protein interacting protein
human IL10-inducible chemokine
Human immunodeficiency virus 1 gp120
Human immunodeficiency virus 1 Nef protein
human immunodeficiency virus tat protein
human immunodeficiency virus Vpr protein
human immunodeficiency virus Vpu protein
Humanin
Humanin G
human inhibitor 30 kDa
human inhibitor angiogenesis factor-1
human inhibitor of apoptosis protein-1
human inhibitor of apoptosis protein-2
humanin-like-1
humanin-like-2
humanin-like-8
humanin-like-12
Humanin-like peptides
human intercrine reduced in hepatomas
human interleukin for Da cells
human intestinal microvascular endothelial cells
human kinase-defective eph-family receptor protein
human leukocyte antigen G
human macrophage-derived chemokine
human macrophage lectin
human macrophage lectin 2
human mast cell-1
human mast cell-1 5C6
Human menopausal gonadotropin
Human metapneumovirus SH protein
Human metapneumovirus small hydrophobic protein
human microvascular endothelial cells
human milk fat globule antigen
human milk growth factor
human milk growth factor-1
human milk growth factor-2
human milk growth factor-3
human MIP-related protein 2A
human MIP-related protein 2B
human mucosal lymphocyte antigen 1
human natural killer-1
human neutrophil antigen 1
human neutrophil antigen 1a
human neutrophil antigen 1b
human neutrophil antigen 1c
human neutrophil antigen 2a
human neutrophil antigen 4a
human neutrophil antigen 5a
human neutrophil granule peptide-1
human neutrophil granule peptide-2
human neutrophil granule peptide-3
human neutrophil granule peptide-4
human neutrophil lipocalin
human neutrophil peptide-1
human neutrophil peptide-2
human neutrophil peptide-3
human neutrophil peptide-4
human pancreatic secretory trypsin inhibitor
human papillomavirus type 16 E5 protein
human pituitary growth factor
human placenta-purified factor
human platelet antigen-1
human platelet antigen-1a
human platelet antigen-1b
human platelet antigen-2
human platelet antigen-2a
human platelet antigen-2b
human platelet antigen-3
human platelet antigen-3a
human platelet antigen-3b
human platelet antigen-4
human platelet antigen-4a
human platelet antigen-4b
human platelet antigen-5
human platelet antigen-5a
human platelet antigen-5b
human platelet antigen-15
human platelet antigen-15a
human platelet antigen-15b
human progenitor cell antigen 1
human protein tyrosine phosphatase-eta
human pulmonary artery endothelial cell-derived survival factor
human pulmonary artery smooth muscle cells
Human respiratory syncytial virus SH protein
Human respiratory syncytial virus small hydrophobic protein
human Ring Finger homologous to Inhibitor of apoptosis protein
human saliva protein 12
human saphenous vein endothelial cells
human seminal plasma factor
Human seminal plasma inhibitor-I
human sequence similar to Yeast 18
Human Skin Fibroblast Elastase
Human T-cell leukemia virus type-1 p13 protein
human thymocyte antigen-1
Human T lymphotropic virus type 1 P13 II protein
human toll
human tumor clonogenic cell assay
human umbilical arterial smooth muscle cells
human uterine angiogenesis factor
human VH1
human VH1 phosphatase homolog
Humig
HumLy9
HUMMAT1H
humoral recognition factor
humoral stimulatory activity
HUMSTR
hunter-killer peptide 1
hunter-killer peptide 9
Hunter-killer peptides
HUP-39
HuR
HUR7
Hurpin
Hurthle cells
Hürthle cells
Hurtle cells
HUSI-I
HUSSY18
HUTCH-1
HuTSP
HUVECs
Huxley cells

HV1
hvCKBP
HVDKKVADKVLLLKQLRIMRLLTRL
HveA
HveAt
HveB
HVEC
HveD
HVEM
HVEM-L
HVEM ligand
HVF18
HVFRLKKWIQKVIDQFGE
hVH1
HVP IL10
HVS13

hWAPL
h-warts
HWAVGGHLM
HWAWFKamide
HWESAS
hWW45

Hx
HXB

Hy
hyalectanase
Hyaline chondrocytes
hyalocytes
Hyaluronan-binding protein 1
hyaluran-mediated motility receptor
Hyaluronan-binding protein involved in hyaluronan depolymerization
Hyaluronan receptor for endocytosis
Hyastatin
HybHPs
HYBID
hybrid cytokine
hybrid hepatocytes
Hybridoma-derived suppressor factor-160
Hybridoma growth factor
Hybridoma/plasmacytoma factor-1
Hybridoma/plasmacytoma growth factor
Hybridoma suppressor factor
Hydra head activator
hydramacin-1
Hydra Morphogen Peptide
Hydra peptide morphogen
hydrocytes
hydrogen peroxide-potentiating factor
hydron
Hydroperoxycyclophosphamide
Hydrophis cyanocinctus cathelicidin
Hydrostatin-SN1
hydrostatin-TL1
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase beta subunit
Hydroxycarboxylic acid receptor 2
Hydroxycarboxylic acid receptor 3
HYL
Hyl
Hylambatin
Hylaranin-L1
Hylaranin-L2
hylaranins
Hylaseptin P1
Hylin a1
Hylin b1
Hylin b2
Hylins
Hymenochirin-1B
Hymenochirin-1Pa
Hymenochirin-2B
Hymenochirin-3B
Hymenochirin-4B
Hymenochirin-5B
Hymenochirins
hymenoptaecin
HYMEQ-5
hyperchromic erythrocytes
hypercytokinemia
hyperelongated Biglycan
hyperglycemic glycogenolytic factor
hyperglycosylated chorionic gonadotropin
Hyperglycosylated hCG
hyperglycosylated hCG free beta-subunit
Hyper-IgM immunodeficiency syndrome
Hyper-IL6
Hyper IL11
Hyperplasia
Hyperplasia suppressor gene
Hyperplastic cells
hyperplastic polyposis gene 1
hyperplastic polyposis protein 1
Hypertensin
hypertensin I
hypertensin II
hypertension-related gene-1
hypertrehalosemic hormone
hypertrophic chondrocytes
hypertrophic chondrocyte-specific gene product 24
Hyphantria cecropin A
hypoblast
hypocalcin
hypochromic erythrocytes
Hypochromic macrocytes
hypocretin
hypocretin 1
hypocretin 2
hypocretin neurons
hypocretin receptor 1
hypocretin receptor 2
hypocretins
hypodense eosinophils
hypogonadal
hypomyelinating leukodystrophy 4
Hyposin-HA1
Hyposin-HA2
Hyposin-HA3
Hyposin-HA4
Hyposin-HA5
Hyposins
Hypotensin-1
Hypotensin-2
Hypotensin-3
Hypotensin-4
Hypotensin-like peptide
Hypotensins
Hypothalamic growth factor
hypothalamic paraventricular nucleus type I neurons
Hypothalamic-pituitary-adrenocortical axis
Hypothalamus-derived endothelial cell growth factor
Hypothalamus-derived growth factor
Hypothalamus-derived growth factor-A
Hypothalamus-derived growth factor-B
hypothyroid
hypoxamiRs
hypoxia and Akt induced stem cell factor
hypoxia-induced angiogenesis regulator
hypoxia-induced gene 95
Hypoxia-induced mitogenic factor
Hy+ protein
hypusine-containing protein
HYRFTCVLTTLNGVS
hyt



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.