hemoglobin-alpha(110-141) |
hemoglobin-alpha(133-138) |
VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG |
||
abbr. HbA(129-134). This fragment derived from the alpha-chain of bovine hemoglobin has been shown to potentiate the activity of bradykinin. See: Hemoglobin.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |