HEIR1 |
HEK1 |
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ |
||
[human embryo kinase] The gene encoding this kinase expressed by human lymphoid tumor cell lines has been cloned by Wicks et al (1992). HEK is a member of a family of tyrosine kinases with a high degree of homology to EPH and ELK tyrosine kinases (Boyd et al, 1992). The cDNA has been identified independently as HEK4 [human embryo kinase-4]. The approved gene symbol is EphA3 [Eph receptor A3] (see: Ephrins). Other designations are human eph/elk-like tyrosine kinase], human embryo kinase-1, and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base