Harlequin molecules |
HARP |
KESVRLCGLEYIRTVIYICASSRW |
||
The cDNA encoding this antimicrobial peptide, SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ, from the ladybug Harmonia axyridis has been cloned by Kim JW et al (2013). The peptide is related in sequence to Sapacin and in some databanks is being referred to as Sapacin B-like peptide.
The peptide is active against Gram-positive bacteria and Gram-negative bacteria and is not hemolytic.
A synthetic homodimer peptide analog derived from harmoniasin has been shown to cause apoptosis and necrosis in human leukemia cell lines such as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |