HADHB |
HAE1 |
tart cells |
||
Hadrurin (GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA) is an antimicrobial peptide from the venom of the scorpion Hadrurus aztecus. It has been shown to inhibit the growth of Salmonella thyphi, Klebsiella pneumoniae, Enterococcus cloacae, Pseudomonas aeruginosa, Escherichia coli and Serratia marscences. It is hemolytic for human erythrocytes. The most probable mechanism of action is through membrane destabilization (Torres-Larios et al, 2000).
Sánchez-Vásquez et al (2013) have synthesized a synthetic peptide combining sequences of vejovine and hadrurin. The synthetic peptide shows improved activity against Gram-negative bacteria
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |