Hemochromatosis 3 |
hemocyte chemotactic peptide |
CD182 |
||
[hemocidin]
A name proposed by Mak et al (2000) for bactericidal peptides, [hemoglobin microbicidal peptides]. derived by proteolytic cleavage of heme-containing proteins hemoglobin and myoglobin, and cytochrome C. Hemocidins are released during proteolytic lysis of hemoglobin in erythrocytes and their generation does not depend on the blood group, Rhesus factor, age and sex of the healthy donors (Ivanov et al, 1998). Hemocidins exhibit a broad spectrum of activity against microorganisms (Parish et al, 2001) and are thought to act as a natural antibiotic.
Examples of hemocidins described by Ivanov et al (1998) include
HbA(1-33) [VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF] and its shortened forms,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |