COPE Media Kit

Cope Home
Previous entry:
Hemochromatosis 3
Next entry:
hemocyte chemotactic peptide
Random entry:
Search COPE:



A name proposed by Mak et al (2000) for bactericidal peptides, [hemoglobin microbicidal peptides]. derived by proteolytic cleavage of heme-containing proteins hemoglobin and myoglobin, and cytochrome C. Hemocidins are released during proteolytic lysis of hemoglobin in erythrocytes and their generation does not depend on the blood group, Rhesus factor, age and sex of the healthy donors (Ivanov et al, 1998). Hemocidins exhibit a broad spectrum of activity against microorganisms (Parish et al, 2001) and are thought to act as a natural antibiotic.

Examples of hemocidins described by Ivanov et al (1998) include

HbA(1-33) [VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF] and its shortened forms, ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=23453