hematohistioblasts |
hematon |
KFRKTCAPMGYCSPKCRVMDLKYTSGDCKYSCCIPTAWKGK |
||
[Hematology MiniCOPE Dictionary]
The Hematology MiniCOPE Dictionary is one of several subdictionaries of COPE. This dictionary contains entries pertaining to blood cells and hematopoiesis and/or directly or indirectly bearing on the involvement of cytokines and growth factors in hematopoiesis. For other topic-specific subdictionaries with contents fully integrated into COPE see also: MiniCOPE Dictionaries.
• 4-HC
• 13T
• 24p3
• 25 kDa alpha-2-microglobulin-related subunit of MMP-9
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |