Hippocampus kuda Bleeker pleurocidin-like peptide |
Hipposin (1-19) |
interleukin-10-induced regulatory T-cells |
||
Hipposin is a polypeptide (SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL) isolated from the skin mucus of Atlantic halibut (Hippoglossus hippoglossus L.) (Birkemo et al, 2003). Hipposin has been shown to be derived from histone H2A and shows sequence similarity with the 39-mer antibiotic peptide buforin-1 of Asian toad and the 19-mer peptide parasin-1 of catfish. 50/51 amino acids in hipposin are identical to the N-terminal region of histone H2A from rainbow trout. The peptide is most closely related to sturgeon Acipensin-1 (see: Acipensins). For bioactive fragments of histone proteins see also: HDAPs [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base