COPE Media Kit


Cope Home
Previous entry:
Heligmosomoides polygyrus TGF-beta mimic
Next entry:
Helios
Random entry:
PTF
Search COPE:

Heliomicin

This antifungal peptide (DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET) has been isolated from the lepidopteran Heliothis virescens (Tobacco budworm moth). Heliomicin is active on yeast species Candida albicans, Pichia pastoris, Aspergillus fumigatus (Thevissen et al, 2004; Landon et al, 2004). Heliomicin interacts with glucosylceramides isolated from P. pastoris and soybean but not with human glucosylceramides (Thevissen et al, 2004).

Heliomicin displays sequence similarities with antifungal plant defensins and antibacterial or antifungal insect defensins. Some selected variants possess both antibacterial and antifungal activities (Lamberty et al, 2001; Landon et al, 2004).

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=23356