HBSP |
HBV core protein |
KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC |
||
[hemoglobin scavenger receptor] The hemoglobin scavenger receptor scavenges haptoglobin / hemoglobin complexes (Kristiansen M et al, 2001). The receptor is a member of the scavenger receptor cysteine-rich (SRCR) family (Ritter et al, 1999) and consists of 9 extracellular group B SRCR domains, a transmembrane segment, and a short cytoplasmic tail (Law et al, 1993) with several potential phosphorylation sites. The receptor has been described to be expressed exclusively in cells of the monocytic lineage, and high expression is seen in phagocytic tissue macrophages (Zwadlo et al, 1987). Shedding of a soluble form of the receptor from in vitro cultured cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |