Hinnavin-2 |
HINT2 |
beta-casein(201-220) |
||
Hinnavins are antibacterial peptide from the larval haemolymph of the cabbage butterfly, Artogeia rapae (Bang et al, 1997). Hinnavin-1 (GWKIGKKLEHMGQNIRDGLISAGPAVFAVGQAATIYAAAK) is a heat-stable peptide that is active against Gram-negative bacteria and Gram-positive bacteria (Bang et al, 1997). Hinnavin-2 (APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG) is more active against Gram-negative than against Gram-positive bacteria and strongly synergizes with lysozyme. Hinnavin-2 shows approximately 78.9 % amino acid sequence identity with cecropin A (Yoe et al, 2006).
For other proteins/peptides with functions in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |