HNGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT |
HNKQEGRDHDKSKGHFHRVVIHHKGGKAH |
MCETs |
||
[HNK-1(+), HNK-1(-)]
[human natural killer-1] HNK-1 (or Leu7) is an IgM monoclonal antibody produced against a membrane extract of a human lymphoblastoid T-cell line (HSB-2) (Abo and Balch, 1981). The antibody reacts with certain human cultured T-cell lines (HSB-2 and MOLT-4 but not MOLT-3) but not with other lines of B-cell or phagocytic cell origin. HNK-1 reacts with 15.1 ± 7.1 % of normal blood lymphocytes but is unreactive with monocytes, granulocytes, erythrocytes, and platelets. HNK-1(+) cells have been identified as NK-cells and K cells.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |