HIV1 Nef protein |
HIV1 protein U |
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR |
||
[HIV-1 matrix protein p17] HIV-1 protein p17 is the N-terminal domain of a larger precursor polyprotein encoded by the HIV-1 gag gene (Freed, 1998). HIV-1 p17 protein is a structural protein critically involved in most stages of the life cycle of the retrovirus. It participates in the pre-integration of the DNA complex into the nucleus during the early stages of virus replication and is involved in viral RNA binding and the transport of the viral protein precursor to the plasma membrane. It also participates in the incorporation of the HIV-1 envelope into virions and the formation of viral particles (for overview see: Fiorentini et al, 2006).
HIV-1 p17 protein has been detected in plasma
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |