hemoglobin-alpha(33-61a) |
hemoglobin-alpha(71-84) |
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK |
||
abbr. HbA(34-68). For this bioactive fragment of hemoglobin see: hemocidins.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |