hemocidins |
hemocytes |
polarized macrophages |
||
abbr. HCP (a term with multiple meanings). Nakatogawa et al (2009) have identified this peptide of 32 amino acids [SVQILRCPDGMQMLRSGQCVATTEPPFDPSY] in the moth Pseudaletia separata (Mythimna separata (Oriental armyworm). Hemocyte chemotactic peptide is a chemotactic cytokine that stimulates the aggregation and directed movement of phagocytic hemocytes and enhances clotting at wound sites in larvae. The peptide is expressed in both epidermal cells and hemocytes. HCP shares similarities with members of the ENF peptide family of insect cytokines.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |