HveD |
HVEM-L |
AGNSDLILPVPAFNVINGGSHAGNKLAMQEF |
||
[Herpesvirus entry mediator] This factor, recently renamed HveA [Herpes simplex virus entry protein A] (Carfi et al, 2001) and known also as HveAt, was identified and cloned by Montgomery et al (1996) as a cellular mediator that rendered virus-resistant hamster and swine cells susceptible to virus infection. Terry-Allison et al (1998) have demonstrated that the protein also participates in virus induced cell fusion. In the nomenclature of CD antigens this protein has been given the designation CD270.
Kwon et al (1997) have mapped the HVEM gene to human chromosome 1p36.3-p36.2. HVEM is a member of the TNF NGF receptor
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |