HbA(88-112) |
HbA(98-114) |
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
||
[Hemoglobin-alpha(97-114)] This fragment of bovine hemoglobin-alpha, termed hemoglobin P3 fragment by the authors, corresponds to a central fragment with the sequence VNFKLLSHSLLVTLASHL (Val-Asn-Phe-Lys-Leu-Leu-Ser-His-Ser-Leu-Leu-Val-Thr-Leu-Ala-Ser-His-Leu).The peptide shows high homology with corresponding regions of sheep, deer, porcine, and human hemoglobin-alpha. The purified peptide shows antimicrobial activity against Escherichia coli, Staphylococcus aureus, and Candida albicans (Hu et al, 2011). Zhang et al (2015) have reported that the peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |