COPE Advertising options



Previous Next
Search COPE:
 


- I -

Select one of the following:


i

I1PP2A
I1R

I5E

i35-Bregs
I-309

IA4
Ia-associated invariant chain
IAF
IAG
Ia-gamma
IAGVGGEKSGGF
IaI
IaI-associated SUPER determinants
IaIF
Ia inducing factor
Ia induction factor
IAK
Ian-5
I antigen
i-antigen
IAP
IAP1
IAP2
IAP3
IAP class 1 proteins
IAP class 2 proteins
IAP class 3 proteins
IAP-like protein
IAP-like protein-1
IAP-like protein-2
IAPP
IAPP(1-8)
IAPP(1-37)
IAQAGEDPHGYFLPGQFAFS
IARRHPYF
IARRHPYFL
IARS
IARS1
Iasi congenital atrichia
iASPP
iASPP/RAI
iASPP-SV
IAV M2 protein

IB1
IB2
IB-367
IBA-1
Ib-AMP
Ib-AMP1
Ib-AMP2
Ib-AMP3
Ib-AMP4
I-BAR domain
IBD1
IBDV VP3 protein
IBE1
I-Beta-1,6-N-acetylglucosaminyltransferase
IBF
I blood group system
Iboctadekin
IBP
IBP72
I-branching enzyme
IBRDC3
IBR domain containing protein 3
ibx

IC
IC-2
iC3b receptor
IC31
ICaBP
ICAD
ICAD-L
ICAD-S
ICAM-1
ICAM-1(+) neutrophils
ICAM-2
ICAM-3
ICAM-4
ICAM-R
ICAM receptor
ICC
ICC-CM
ICC-DMP
ICC-IM
ICC-like cells
ICC-LM
ICC-MP
ICC-MY
ICC-SEP
ICC-SM
ICC-SMP
ICC-SS
ICD
ICE
ICE-alpha
ICE and CED3 homolog-1
ICE and CED3 homolog-2
ICE and CED3 homolog-3
ICEBERG
ICE-beta
icebox
ICE-delta
ICE-epsilon
ICE-gamma
ICE-LAP3
ICE-LAP6
ICE-like apoptotic protease-3
ICE-like apoptotic protease-6
I cells
ICE protease-activating factor
ICERE1
ICErel-2
ICErel-3
ICE-zeta
ICF syndrome
ICH-1
ICH-1L
ICH-1s
ICH-2
ICH-3
ICH3
ICIFCCGCCHRSKCGMCCKT
icIL1ra
icIL1ra2
icIL1ra3
icIL1ra type 2
icIL1ra type 3
ICLC
ICLKKWPWWPWRRCKamide
ICln-binding protein of 72 kDa
ICM
ICOS
ICOSL
ICOSLG
ICOS ligand
ICP0
ICP6
ICP10
ICP10PK
ICP22
ICP27
ICP27t2
ICP34.5
ICPP
icREN
ICRF
ICSAT
ICSBP
ICSBP-1
iCSCs
ICSH

ID1
ID2
ID3
ID3a
ID4
IDB1
IDB2
IDB3
IDB4
iDC
Iddm1
IDDM10
IDE
IDECs
IDF-45
IDGF
IDGF-2
IDGFL
IDGF-like
IDH3GL
IDMM19
i-dNK-cells
IDR-1
IDR-1002
IDR-1018
IDR-2009
IDR-HH2
IDRs
IDS
Iduna
IDWKKLLDAAKQIL
IDWKKVDWKKVSKKTCKVMLKACKFLG

IE1
IE2
IE63
IE72
IE86
IE110
IE1-72
IE2-86
ieAstrocytes
IE-CTL
IEF SSP 3521
IEGs
IEGF
IEGPTLRQWLAARA
ieILC1s
IEL
IE proteins
IER2
IER3
IETD
IETD-AFC
IETD-AMC
IETDase
IETD-CHO
IETD-fmk
IETD-pNA
IETWILRHP
IEX1
IEX-1L
IEX-1S

IF
IF1
IF3
I factor
IFB
IFC antigen
IFF
IFGAIAGLLKNIFamide
IFGAILPLALGALKNLIKamide
IFGAIWKGISSLL
IFGAIWNGIKS
IFGAIWNGIKSLFamide
iFGF family
IFGP1
IFGP2
IFGP3
IFGP4
IFGP family protein 1
IFGP family protein 2
IFGP family protein 3
IFGP family protein 4
IFGR2
IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT
IFI6
Ifi10
IFI15
IFI-15K
IFI16
IFI16-alpha
IFI16-beta
IFI16 inflammasome
IFI17
IFI27
IFI35
IFI54
IFI54K
IFI56
IFI56K
IFI60
IFI-78
IFI-78k
IFI200 family
Ifi202
Ifi204
Ifi210
Ifi-6-16
IFIH1
IFIT1
IFIT2
IFIT3
IFIT4
IFIT5
if it is secreted I like it
IFITM1
IFITM2
IFITM3
Ifitm like
IFIX
IFL
I-FLICE
IF-M2B-alpha
IFN1@
IFN-1
IFN-2
IFN-3
IFN-4
IFNA
IFNA1
IFNA13
IFNABR
IFN-alpha
IFN-alpha-1
IFN-alpha 1b
IFN-alpha-2
IFN-alpha-2a
IFN-alpha-2b
IFN-alpha-2b-inducing-related protein 1
IFN-alpha-4
IFN-alpha(9-28)
IFN-alpha-1(152-189)
IFN-alpha II1
IFN-alpha/beta
IFN-alpha/beta receptor 1
IFN-alpha/beta receptor 2
IFN-alpha Con1
IFN-alphaD
IFN-alphaLe
IFN-alphaLy
IFN-alphaomega
IFN-alphaR1
IFN-alphaR2
IFN-alpha signature
IFNAR
IFNAR1
IFNAR2
IFNAR2a
IFNAR2b
IFNAR2c
IFN-AW
IFNB
IFNB1
IFN-beta
IFN-beta-1
IFN-beta-2
IFN-beta(150-187)
IFN-beta inducing factor
IFN-c
IFN-delta
IFN-delta-1
IFN-delta-2
IFN-delta-8
IFNE
IFNE1
IFN-epsilon
IFN fibroblast
IFNG
IFN-gamma
IFN-gamma-activated inhibitor of translation complex
IFN-gamma inducible secretoglobin
IFN-gamma inducible protein 10
IFN-gamma-inducible protein gamma-2
IFN-gamma inducing factor
IFN-gamma inducing factor binding protein
IFNgamma-MdC
IFN-gamma-producing B-cells
IFN-gamma-producing immature myeloid cells
IFN-gamma-producing innate B-cells
IFN-gamma-R1
IFN-gamma-R2
IFN-gamma receptor-1
IFN-gamma receptor 2
IFN-gamma regulated human melanoma-associated antigen
IFN-gamma-stimulated monocyte-derived cells
IFNGIP1
IFNGR1
IFNGR2
IFNGT1
IFN-I
IFN-II
IFN-II receptor
IFN-inducible protein 10
IFNK
IFN-kappa
IFNL
IFNL1
IFNL2
IFNL3
IFNL4
IFN-lambda
IFN-lambda-1
IFN-lambda-2
IFN-lambda-3
IFN-lambda-4
IFN-lambda-R1
IFN-lambda receptor 1
IFN leukocyte
IFN-like 1
IFNLR
IFNLR1
IFN-omega
IFN-omega-1
IFNphi1
IFNphi2
IFNphi3
IFNphi4
IFN-producing cells
IFN regulatory factor 3-dependent NK-activating molecule
IFNRG1
IFNs
IFN-ss
IFNT
IFNT1
IFNT4
IFNT11
IFN-tau
IFN-tau-4
IFN-tau-6d
IFN-tau-11
IFN-tau(156-195)
IFNW
IFNW1
IFN-zeta
IFP35
IFP53
IFRC
IFRD1
IFT57
IFT121
IFTA-1

IG-19
IG20
IGA
IgA cells
IgA-EF
IgA enhancing factor
IgA-Inducing Protein
Ig-alpha
IgA receptor
IgA regulatory protein
IGB
Ig-beta
IGBPs
IG cells
IgD(-) B-cells
IGDC1
IGDCC1
IGDCC2
IgD cells
IgE-BF
IgE binding factor
IgE binding factor epsilon
IgE cells
IgE-dependent histamine releasing factor
IgE-EF
IgE enhancing factor
IgE Fc receptor subunit beta
IgE-HRF
IgE switch factor
IGF
IGF-1
IGF-1A
IGF-1B
IGF-1 Ea
IGF-1 Eb
IGF-1 Ec
IGF1R
IGF-1 receptor
IGF-2
IGF2/M6P receptor
IGF2R
IGF-2 receptor
IGF1(1-3)
IGF-3
IGF2(93-126)
IGFALS
IGF binding protein-1
IGF binding protein-2
IGF binding protein-3
IGF binding protein-4
IGF binding protein-5
IGF binding protein-6
IGF binding protein-7
IGF binding protein-8
IGF binding protein-9
IGF binding protein-10
IGF binding protein-like-1
IGF binding protein related protein-1
IGF binding protein related protein-2
IGF binding protein related protein-3
IGF binding protein related protein-4
IGF binding protein related protein 10
IGFBPs
IGFBP1
IGFBP1a
IGFBP1b
IGFBP2
IGFBP2a
IGFBP2b
IGFBP3
IGFBP3R
IGFBP3 receptor
IGFBP4
IGFBP4 protease
IGFBP5
IGFBP5a
IGFBP5b
IGFBP5-protease
IGFBP6
IGFBP6a
IGFBP6b
IGFBP7
IGFBP8
IGFBP9
IGFBP10
IGF-BP25
IGFBP5[193-214]
IGFBP complex acid labile subunit
IGFBPL1
IGFBPrP1
IGFBPrP2
IGFBPrP3
IGFBPrP4
IGFBPrP10
IGF family
IGFL1
IGFL2
IGFL3
IGFL4
IGF-like family member 1
IGF-like family member 2
IGF-like family member 3
IGF-like family member 4
IGFLR1
IGF-like family receptor 1
IGFR2
IgG1-EF
IgG1-enhancing factor
IgG1 Eu heavy chain (364-373)
IgG1 Eu heavy chain (369-373)
IgG1 heavy chain (11-20)
IgG1 heavy chain (364-373)
IgG1 heavy chain (369-373)
IgG1-IF
IgG1-induction factor
IgG1 secretion factor
IgG1-SF
IgG1 VH (11-20)
IgG1 VH (289-292)
IgG2-IF
IgG2b inducing factor
IgG cells
IgG heavy chain (289-292)
IgG heavy chain (341-344)
IgG VH (341-344)
IGI
IGIF
IGIF binding protein
IGIFBP
IGIP
IGKEFKRIVQRIKDFLRNL
IGL5
IGLL1
Ig lambda-5
IGLHDPSHGTLPNGS
IgLON
IGLON1
IGLON2
IGLON3
IGLON4
IGLON5
IgLON family member 1
IgLON family member 2
IgLON family member 3
IgLON family member 4
IgLON family member 5
IgM cells
IgM Fc receptor
IgM memory B-cells
Ig-NRG1
IGNT
IGPR-1
IGSF1
IGSF2
IGSF8
IGSF11
IGSF12
IGSF13
IGSF16
Ig synthesis/secretion suppressor factor
IGUP 1-3524
IGVPB

Ih2 cells
IHABP
iHeps
IHG-2
IHH
Ihhb
Ihog
IHRP
iHSC

IIAEK
Ii blood group system
IIEKLVNTALGLLSGLamide
IIF
IIF-2
IIGLM
IIGLVSKGTCVLVKTVCKKVLKQG
IIGPVLGLVGKALGGLLamide
IIGPVLGLVGSALGGLLKKI
IIGPVLGLVGSALGGLLKKIG
IIGPVLGMVGSALGGLLKKIG
IIIQYEGHKH
IIKVPLKKFKSMRDVMRHEGIKAPVVHPATKY
IIPLPLGYFAKKKKKKDPVPLDQ
IIPLPLGYFAKKP
IIPLPLGYFAKKT
IIS

IK
I-kappa-B
I-kappa-B-alpha
I-kappa-B-beta
I-kappa-B-delta
I-kappa-B-epsilon
I-kappa-B-gamma
I-kappa-B-gamma-1
I-kappa-B-gamma-2
I-kappa-B kinase-1
I-kappa-B kinase-2
I-kappa-B-kinase-alpha
I-kappa-B-kinase-beta
I-kappa-B kinase-gamma
I-kappa-B-zeta
Ikaros family zinc finger 2
Ikaros family zinc finger protein 2
IKBKA
IKBKB
IKBKG
IKCDTCGKECASACGTKHFRTCCFNYL
IK cytokine
IKDCs
IK factor
IKHQGLPQE
IKIMHILAKLGKVLAEVamide
IKIPAFVKDTLKKVAKGVISAVAGALTQ
IKIPAVVKDTLKKVAKGVLSAVAGALTQ
IKIPPIVKDTLKKVAKGVLSTIAGALST
IKIPSFFRNILKKVGKEAVSLIAGALKQS
IKITTMLAKLGKVLAEVamide
IKK-1
IKK-2
IKKA
IKK-alpha
IKKB
IKK-beta
IKK-gamma
IKLSPETKDNLKKVLKGAIKGAIAVAKMVamide
IKVAV
IKZF2

IL
IL1
IL1A
IL1-alpha
IL1B
IL1BC
IL1BCE
IL1-beta
IL1-beta-1
IL1-beta-2
IL1-beta(163-171)
IL1-beta Convertase
IL1-beta Convertase-related-2
IL1-beta Convertase-related-3
IL1-beta converting enzyme
IL1-beta converting enzyme-alpha
IL1-beta converting enzyme-beta
IL1-beta converting enzyme-delta
IL1-beta converting enzyme-epsilon
IL1-beta converting enzyme-gamma
IL1-beta-converting enzyme-related proteases
IL1-beta converting enzyme-zeta
IL1-delta
IL1-epsilon
IL1-eta
IL1F1
IL1F2
IL1F3
IL1F4
IL1F5
IL1F6
IL1F7
IL1F7a
IL1F7b
IL1F7c
IL1F7d
IL1F7e
IL1F8
IL1F9
IL1F10
IL1F11
IL1 family
IL1 family member 1
IL1 family member 2
IL1 family member 3
IL1 family member 4
IL1 family member 5
IL1 family member 6
IL1 family member 7
IL1 family member 7a
IL1 family member 7b
IL1 family member 7c
IL1 family member 7d
IL1 family member 7e
IL1 family member 8
IL1 family member 9
IL1 family member 10
IL1 family member 11
IL1-gamma
IL1H
IL1H1
IL1H2
IL1H3
IL1H4
IL1HL
IL1HLa
IL1 homolog-1
IL1 homolog-2
IL1 homolog-3
IL1 homolog-4
IL1HS
IL1-HY1
IL1-HY2
IL1/IL18 family
IL1-inducible 26k factor
IL1 inhibitor
IL1 inhibitory activity
IL1 inhibitory protein
IL1k
IL1-L1
IL1-like protein-1
IL1R
IL1R1
IL1R2
IL1R3
IL1R4
IL1R5
IL1R6
IL1R7
IL1R8
IL1R9
IL1RA
IL1ra
IL1ra1
IL1ra2
IL1ra3
IL1raBF
IL1R accessory protein-like
IL1RAcP
IL1RAcPL
IL1R-alpha
IL1RAP
IL1RAPL
IL1RAPL1
IL1RAPL2
IL1RB
IL1R-beta
IL1 receptor
IL1 receptor accessory protein
IL1 receptor accessory protein-like
IL1 receptor accessory protein-like-1
IL1 receptor accessory protein-like-2
IL1 receptor-alpha
IL1 receptor antagonist
IL1 receptor antagonist-1
IL1 receptor antagonist-2
IL1 receptor antagonist-3
IL1 receptor antagonist protein
IL1 receptor-associated kinase
IL1 receptor-associated kinase-1
IL1 receptor-associated kinase-1b
IL1 receptor associated kinase 1 binding protein 1
IL1 receptor-associated kinase-1c
IL1 receptor-associated kinase-1S
IL1 receptor-associated kinase-2
IL1 receptor-associated kinase-3
IL1 receptor-associated kinase-4
IL1 receptor-associated kinase M
IL1 receptor-associated kinase S
IL1 receptor-associated kinase W
IL1 receptor-beta
IL1 receptor family
IL1 receptor-like-1
IL1 receptor-like-1 ligand
IL1 receptor-like 2
IL1 receptor R1
IL1 receptor R2
IL1 receptor R3
IL1 receptor R4
IL1 receptor R5
IL1 receptor R6
IL1 receptor R7
IL1 receptor R8
IL1 receptor R9
IL1 receptor-related protein
IL1 receptor-related protein-1
IL1 receptor-related protein-2
IL1 receptor type 1
IL1 receptor type 2
IL1-related protein-1
IL1-related protein-2
IL1-related protein-3
IL1RL1
IL1RL1 binding protein
IL1RL1L
IL1RL1LG
IL1RL1 ligand
IL1RL2
IL1RN
IL1RP1
IL1RP2
IL1RP3
IL1Rrp
IL1Rrp1
IL1Rrp2
IL1 suppressor factor
IL1ss
IL1-theta
IL1-zeta
IL2
IL2 dimers
IL2 enhancing factor
IL2-inducible T-cell kinase
IL2-LAK therapy
IL2R
IL2RA
IL2R-alpha
IL2R-alpha chain inhibitory activity
IL2RB
IL2R-beta
IL2 receptor
IL2 receptor-alpha
IL2 receptor-beta
IL2 receptor-gamma
IL2 receptor inducing factor
IL2RG
IL2R-gamma
IL2-RIF
IL2R/p55 inducing factor
IL3
IL3-alpha
IL3-beta
IL3-IAP
IL3 inhibitor p16
IL3-LA
IL3-like activity
IL3RA
IL3R-alpha
IL3RB
IL3R-beta
IL3 receptor affinity converter
IL3 receptor subunit beta
IL4
IL4BP
IL4-delta-2
IL4 induced nuclear-activating factor
IL4 induced secreted protein
IL4-NAF
IL4-producing B-cells
IL4R
IL4RA
IL4R-alpha
IL4 receptor targeting peptide
IL4RI
IL4RII
IL4-STAT
IL5
IL5RA
IL5R-alpha
IL5RB
IL5R-beta
IL5 receptor subunit beta
IL6
IL6DBP
IL6-Delta-4
IL6-dependent DNA binding protein
IL6 family
IL6 G-CSF related factor
IL6 inducing factor
IL6R
IL6RA
IL6R-alpha
IL6RB
IL6R-beta
IL6RE
IL6 receptor soluble urinary protein
IL6 receptor superantagonists
IL6 responsive element
IL6R-SUP
IL6 signal transducer
IL6ST
IL7
IL7-associated pre-pro-B-cell growth stimulating factor
IL7R
IL7RA
IL7R-alpha
IL8
IL8 converting enzyme
IL8-derived peptide
IL8nL
IL8 peptide
IL8 protease
IL8R1
IL8R2
IL8RA
IL8R-alpha
IL8RB
IL8R-beta
IL8 receptor-1
IL8 receptor-2
IL8X
IL9
IL9-producing T-cells
IL9R
IL9 receptor
IL10
IL10a
IL10 antigen-presenting cells
IL10 APC
IL10b
IL10C
IL10-competent B-cells
IL10-competent regulatory B-cells
IL10D
IL10 DCs
IL10-differentiated dendritic cells
IL10 family
IL10-induced regulatory T-cells
IL10-iTr
IL10-iTregs
IL10-producing B-cells
IL10-producing dendritic cells
IL10-producing iNKT-cells
IL10-producing innate lymphoid cells
IL10-producing invariant natural killer T-cells
IL10-producing T-cells
IL10R
IL10R1
IL10R2
IL10RA
IL10R-alpha
IL10RB
IL10R-beta
IL10 receptor-alpha
IL10 receptor-beta
IL10 receptors
IL10-related T-cell derived inducible factor
IL11
IL11a
IL11b
IL11RA
IL11RA1
IL11RA2
IL11R-alpha
IL11R-alpha-1
IL11R-alpha-2
IL11Ralpha-locus chemokine
IL11RB
IL11R-beta
IL12
IL12A
IL12-alpha
IL12B
IL12-beta
IL12 family
IL12-p35
IL12-p40
IL12-p70
IL12-p70 inhibitory activity
IL12-p80
IL12R
IL12RB
IL12RB1
IL12RB2
IL12R-beta
IL12R-beta-1
IL12R-beta-2
IL12 receptor
IL12 receptor-beta
IL12 receptor-beta-1
IL12 receptor-beta-2
IL13
IL13BP
IL13/IL22-coproducing cells
IL13p
IL13 peptide
IL13RA
IL13RA1
IL13RA2
IL13R-alpha-1
IL13R-alpha-2
IL13 receptor-alpha-1
IL13 receptor-alpha-2
IL14
IL14-alpha
IL14-beta
IL15
IL15RA
IL15R-alpha
IL15RB
IL15R-beta
IL15 receptor-alpha
IL15 receptor-beta
IL16
IL17
IL17A
IL17A/F
IL17-alpha
IL17A-producing neutrophil-regulatory Tn lymphocytes
IL17B
IL17B receptor
IL17BR
IL17C
IL17D
IL17E
IL17F
IL17 family
IL17-producing innate lymphoid cells
IL17-producing NKT-cells
IL17-producing T-cells
IL17-producing Th2 cells
IL17R
IL17RA
IL17RB
IL17RC
IL17RC(376-387)
IL17RD
IL17RE
IL17 receptor A
IL17 receptor B
IL17 receptor C
IL17 receptor D
IL17 receptor E
IL17 receptor E-like
IL17 receptor homolog-1
IL17 receptor-like gene
IL17 receptors
IL17REL
IL17RE-like
IL17Rh1
IL17Rhom
IL17RL
IL17RLM
IL17RLM-L
IL17RLM-S
IL17-secreting T-cells
IL17(+) T-helper cells
IL17-Th2 cells
IL18
IL18 binding protein
IL18BP
IL18BPa
IL18BPb
IL18BPc
IL18BPd
IL18R1
IL18RA
IL18RAcP
IL18R-alpha
IL18RAP
IL18RB
IL18R-beta
IL18 receptor-1
IL18 receptor accessory protein
IL18 receptor-alpha
IL18 receptor-beta
IL18 type 2
IL19
IL20
IL20 family
IL20L
IL20-like
IL20R1
IL20R2
IL20RA
IL20R-alpha
IL20RB
IL20R-beta
IL20 receptor-1
IL20 receptor-2
IL21
IL21iso
IL21R
IL21RA
IL21R-alpha
IL21 receptor-alpha
IL22
IL22 binding protein
IL22BP
IL22-producing innate lymphoid cells
IL22-producing T-cells
IL22R
IL22R1
IL22RA1
IL22RA2
IL22R-alpha-1
IL22R-alpha-2
IL23
IL23A
IL23-alpha
IL23-p19
IL23-p19/EBI-3
IL23-p40
IL23R
IL24
IL25
IL25R
IL26
IL27
IL27A
IL27-alpha
IL27B
IL27-beta
IL27p28
IL27p28/IL12-p40
IL27R
IL27R-alpha
IL27RA
IL27 receptor-alpha
IL28
IL28A
IL28-alpha
IL28B
IL28-beta
IL28C
IL28R1
IL28RA
IL28R-alpha
IL29
IL30
IL31
IL31RA
IL31R-alpha
IL31RB
IL31R-beta
IL31 receptor-alpha
IL31 receptor-beta
IL32
IL32-alpha
IL32-beta
IL32-delta
IL32-epsilon
IL32-eta
IL32-gamma
IL32-theta
IL32-zeta
IL33
IL33R
IL33 receptor
IL34
IL35
IL35-induced regulatory T-cells
IL35-iTregs
IL35-producing B-cells
IL35-producing induced regulatory T-cells
IL35-producing regulatory B-cells
IL36
IL36A
IL36-alpha
IL36B
IL36-beta
IL36G
IL36-gamma
IL36R
IL36Ra
IL36RN
IL36s
IL37
IL37a
IL37b
IL37c
IL37d
IL37e
IL38
IL39
IL40
IL41
IL233
IL2[22-58]
IL8(72-94)
IL8(80-99)
IL8(81-99)
IL33(1-270)
IL33(95-270)
IL33(99-270)
IL33(109-270)
ILA
ILANDLTAPGPR
ILAP
IL-B4
ILC
ILC1 cells
ILC1s
ILC2 cells
ILC2s
ILC3 cells
ILC3s
ILC10
ILC17
ILC22
ILCregs
ILCs
ILC type 1 cells
ILC type 2 cells
ILC type 3 cells
IL-D110
Ile3-oxytocin
Ile3-vasopressin
Ile-Ala-Arg-Arg-His-Pro-Tyr-Phe-Leu
Ile-Ala-Lys
Ile-Arg-Trp
Ile-Enkephalin
Ile-Gln-Trp
Ile-Glu-Thr-Asp
Ile-Gly-Leu-His-Asp-Pro-Ser-His-Gly-Thr-Leu-Pro-Asn- Gly-Ser
ILEI
Ile-Ile-Ala-Glu-Lys
Ile-Ile-Gly-Leu-Met
ILELAGNAARDNKKTRIIPRHLQL
Ile-Leu-Ala-Pro
Ile-Leu-Tyr-Met-Pro
Ile-Lys-His-Gln-Gly-Leu-Pro-Gln-Glu
ileocytes
Ile-Pro-Gly-Val-Gly
Ile-Pro-Pro
IleRS
Ile-Ser-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg
Ile-Ser-Asp-Arg-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe
Ile-Ser-Bradykinin
Ile-Ser-Leu-Met-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg
Ile-Tyr-Leu-Gly-Gly-Pro-Phe-Ser-Pro-Asn-Val-Leu
ILF
IL-Four INDuced
ILGAIIPLVSGLLSHLamide
ILGF
ILGF1
ILGF2
ILGKIWEGIKS
ILGKIWEGIKSLFamide
ILGKLLSTAAGLLSNLamide
ILGPVISKIGGVLGGLLKNL
ILGPVISTIGGVLGGLLKNL
ILGPVLGLVGNALGGLIKKI
ILGPVLGLVSDTLDDVLGIL
ILGPVLSMVGSALGGLIKKI
ILGTILamide
ILGTILGLLKGLamide
ILGTILGLLKSL
ILHP1
ILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
ILINCK
ILKKWPWWPWRRKamide
Ilotropin
ILP
ILP-1
Ilp1
ILP-2
Ilp2
Ilp3
Ilp4
Ilp5
Ilp6
Ilp7
Ilp8
ILP-(1-31)
ILPFLAGLFSKIL
ILPFVAGVAAEMMQHVYCAASKKC
ILPILGNLLNGLLamide
ILPILGNLLNSLLamide
ILPILSLIGGLL
ILP-interacting protein
ILPIP
ILPIP-alpha
ILPIP-beta
ILPLVGNLLNDLLamide
ILPWKWPWWPWRRamide
ILQKAVLDCLKAAGSSLSKAAITAIYNKIT
ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRNamide
iLRP
ILRS
ILS
IL-T
ILT1
ILT2
ILT3
ILT4
ILT5
ILT6
ILT7
ILT8
ILT9
ILT10
ILT11
IL-TIF
IL-TIF-alpha
IL-TIF-beta
IL-X
IL-Y
ILYMP
ilys-3

im
Im-1
IM1
IM2
IM3
IM4
IM5
IM6
IM8
IM9
IM10
IM11
IM12
IM13
IM14
IM15
IM16
IM17
IM18
IM19
IM21
IM23
IM24
IM25
IM26
IM27
IM29
IM30
IM31
IM33
IM-54
IMAC
Imaginal Disc Growth Factor-2
Imaginal Disc Growth Factors
Imaginal morphogenesis protein-Late 2
imaginal oenocytes
Imcroporin
IMD
imd
IMD1
IMD3
IMD4
IMD12
IMD(1-47)
IMD(1-53)
IMD(8-47)
iMG cells
imHSCs
Imidazoline receptor 1
Imidazoline Receptor Antisera-Selected
IML-1
IML-2
IML-3
IML-4
IML-5
IML-V
immature B-cells
immature B-lymphocytes
Immature hematopoietic stem cells
immature Laminin Receptor Protein
immature NK-cells
immature single positive cells
immature sinus histiocytes
immediate-early astrocytes
immediate early genes
immediate early protein 1
immediate early protein 2
immediate early protein 63
immediate early protein 110
immediate-early response-3
Immediate early response gene 2
immediate-early response genes
immortalization-upregulated protein 1
immortalization-upregulated protein 2
immortalized cells
Immukin
Immulectin-1
Immulectin-2
Immulectin-3
Immulectin-4
immulectin-5
Immulectins
immulectin-V
Immune activation gene-2
immune-associated nucleotide-5
immune cells
immune checkpoints
Immune Deficiency
immune evasion proteins
immune evasion viroceptor-1
Immune-induced Molecule 1
Immune-induced Molecule 2
Immune-induced Molecule 3
Immune-induced Molecule 4
Immune-induced Molecule 5
Immune-induced Molecule 6
Immune-induced Molecule 8
Immune-induced Molecule 9
Immune-induced Molecule 10
Immune-induced Molecule 11
Immune-induced Molecule 12
Immune-induced Molecule 13
Immune-induced Molecule 14
Immune-induced Molecule 15
Immune-induced Molecule 16
Immune-induced Molecule 17
Immune-induced Molecule 18
Immune-induced Molecule 19
Immune-induced Molecule 21
Immune-induced Molecule 23
Immune-induced Molecule 24
Immune-induced Molecule 25
Immune-induced Molecule 26
Immune-induced Molecule 27
Immune-induced Molecule 29
Immune-induced Molecule 30
Immune-induced Molecule 31
Immune-induced Molecule 33
immune-induced peptide 1
immune-induced peptide 2
immune-induced peptide 3
immune-induced peptide 4
immune-induced peptide 5
immune-induced peptide 6
immune-induced peptide 8
immune-induced peptide 9
immune-induced peptide 10
immune-induced peptide 11
immune-induced peptide 12
immune-induced peptide 13
immune-induced peptide 14
immune-induced peptide 15
immune-induced peptide 16
immune-induced peptide 17
immune-induced peptide 18
immune-induced peptide 19
immune-induced peptide 21
immune-induced peptide 23
immune-induced peptide 24
immune-induced peptide 25
immune-induced peptide 26
immune-induced peptide 27
immune-induced peptide 29
immune-induced peptide 30
immune-induced peptide 31
immune-induced peptide 33
Immune interferon
immune interferon receptor 1
immune interferon receptors
Immune-neuroendocrine axis
Immune protein-10
immune receptor expressed on myeloid cells 1
immune receptor expressed by myeloid cells 2
immune receptor expressed by myeloid cells 3
Immune receptor translocation-associated protein 1
Immune receptor translocation-associated protein 1A
Immune receptor translocation-associated protein 1B
Immune receptor translocation-associated protein 1C
Immune receptor translocation-associated protein 2
Immune receptor translocation-associated protein 3
Immune receptor translocation-associated protein 4
Immune receptor translocation-associated protein 5
immune regulatory cells
Immune response deficient 5
Immune response deficient 7
Immune response deficient 15
Immune semaphorins
immune suppressive protein of stress
immune suppressor factor
Immune suppressor factor J6B7
Immuneron
Immunoadhesins
Immunoassays
immunoblasts
Immunocalins
Immunocasp-3
Immunocasp-6
immunocompetent cells
immunocorticotropin
Immunocortin
immunocytes
Immunocytokines
immunodeficiency 1
immunodeficiency 3
immunodeficiency 4
immunodeficiency with hyper-IgM immunodeficiency 3
immunodeficiency 12
Immunodeficiency-centromeric instability-facial anomalies syndrome 1
immunodeficient mice
immunoedited cells
immunoediting
immunoevasins
immunogenic apoptosis
immunogenic cell death
Immunoglobulin A Fc receptor
Immunoglobulin binding factors
immunoglobulin containing and proline rich receptor-1
immunoglobulin G Fc receptor 2
Immunoglobulin G1 heavy chain (11-20)
Immunoglobulin G1 heavy chain (364-373)
Immunoglobulin G1 heavy chain (369-373)
Immunoglobulin G heavy chain (289-292)
Immunoglobulin G heavy chain (341-344)
Immunoglobulin heavy chain-binding protein
Immunoglobulin heavy chain class switching
immunoglobulin iota chain
immunoglobulin lambda-like polypeptide 1
immunoglobulin-like domain
immunoglobulin-like domain-containing 1
immunoglobulin-like transcript 1
immunoglobulin-like transcript 2
immunoglobulin-like transcript 3
immunoglobulin-like transcript 4
immunoglobulin-like transcript 5
immunoglobulin-like transcript 6
immunoglobulin-like transcript 7
immunoglobulin-like transcript 8
immunoglobulin-like transcript 9
immunoglobulin-like transcript 10
immunoglobulin-like transcript 11
immunoglobulin omega polypeptide
immunoglobulin-producing cells
Immunoglobulin production stimulating factor
Immunoglobulin production stimulating factor-2-alpha
Immunoglobulin production stimulating factor-2-beta
immunoglobulin-related protein 14.1
immunoglobulin superfamily containing LRR
Immunoglobulin superfamily DCC subclass member 1
Immunoglobulin superfamily DCC subclass member 2
immunoglobulin superfamily gene 1
immunoglobulin superfamily gene 2
immunoglobulin superfamily member 8
immunoglobulin superfamily member 11
immunoglobulin superfamily member 12
immunoglobulin superfamily member 13
immunoglobulin superfamily member 16
Immunoglobulin superfamily receptor translocation associated 1
Immunoglobulin superfamily receptor translocation associated 2
Immunoglobulin superfamily receptor translocation associated 3
Immunoglobulin superfamily receptor translocation associated 4
Immunoglobulin superfamily receptor translocation associated 5
ImmunoGrB
immunologic accessory cells
immunologically competent cells
immuno-miRs
immunomodulation
immunomodulatory microRNAs
Immunophilins
immunoradiometric assay
immunoreactive fibroblast growth factor
immunoreceptor tyrosine-based activation motif
immunoreceptor tyrosine-based inhibitory motif
immunoreceptor tyrosine-based switch motif
immunoregulatory microRNAs
immunoregulatory NK-cells
Immunoregulin HA
Immunoregulin TP 1
Immunorphin
immunosubversion
immunosuppressive acidic protein
Immunosuppressive factor
Immunotoxin
Immunotransmitters
immunotrophins
IMP
Impatiens balsamina antimicrobial peptide-1
Impatiens balsamina antimicrobial peptide-2
Impatiens balsamina antimicrobial peptide-3
Impatiens balsamina antimicrobial peptide-4
Impatiens balsamina antimicrobial peptides
IMP dehydrogenase 1
IMPDH1
Imp-L2
Implantin
Importin-alpha re-exporter
Impressed-by-contrast cells
imprinted in placenta and liver
IMUP-1
IMUP-2

IN-1 antigen
IN1
IN2
IN3
IN4
IN5
In(A)
INA-6
Inab
Inactive glycosyltransferase 25 family member 3
INAM
iNampt
In(B)
In blood group antigen
INCA
INCAM-110
inclusion body cells
inclusion cells
increased in high clucose-2
Increasing Capillary1
Increasing Capillary2
increasing capillary permeability protein
incretins
Indian blood group antigen
Indian hedgehog
Indian Hedgehog b
Indian hedgehog homolog
Individual cell necrosis
indoleamine-accumulating amacrine cells
Indolicidin
induced by lymphocyte activation
induced cancer stem cells
induced dNK-cells
induced endothelial cells
induced gene expression
induced hematopoiesis
induced hematopoietic stem cells
induced hepatocyte-like cells
induced HSCs
induced microglia-like cells
induced pluripotent stem cells
induced pluripotent cells-transcription factor-based transdifferentiation
induced regulatory T-cells
Induced-resembled neuronal cells
induced Schwann cells
induced tissue-specific stem cells
induced Tregs
induced T-to-natural killer cells
inducer T-cells
inducible brown adipocytes
inducible cellular adhesion molecule 110 kDa
Inducible Costimulator
Inducible membrane protein R2
inducible osteoprogenitor cells
inducible regulatory T-cells
inducible T-cell co-stimulator
inducible T-cell co-stimulator ligand
Inducible T-cell kinase
INF-alpha
INF-beta
infected cell polypeptide 22
infected cell polypeptide 27
infected cell protein 0
infected cell protein 6
infected cell protein 10
infected cell protein 22
infected cell protein 27
infected cell protein 34.5
infection response gene 1
infection response gene 2
Infectious bursal disease virus VP3 protein
infectious laryngotracheitis virus glycoprotein G
Infectious spleen and kidney necrosis virus 48R protein
Infectious spleen and kidney necrosis virus orf48R
Infergen
INF-gamma
INFI
inflamm-ageing
Inflammaging
inflammamiRs
Inflammasome
inflammation
inflammation-associated microRNAs
Inflammation factor protein 20
inflammation-induced angiogenesis
inflammation modulatory protein
inflammatory bowel disease 1
inflammatory caspases
inflammatory cell death
inflammatory cells
inflammatory chemokines
inflammatory dendritic epidermal cells
inflammatory macrophages
inflammatory microRNAs
inflammatory monocytes
inflammatory protein 10
inflammatory T-helper cells
Influenza A virus matrix protein 2
Influenza B virus matrix protein 2
Influenza C virus matrix protein 2
Influenza virus BM2 protein
Influenza virus CM2 protein
Influenza virus M1 matrix protein
Influenza virus M2 protein
Influenza virus NB protein
Influenza A virus NS1 protein
Influenza B virus NS1 protein
informosomes
ING1
ING1L
ING1-like
ING2
ING2a
ING2b
ING3
ING4
ING5
INGAP
INGAP(104-118)
INGAP-P
INGAP pentadecapeptide
INGAP Peptide
INGAP-PP
INGAP-related pentadecapeptide
INGAP-related protein
INGAPrP
INGX
INHA
INHBA
INHBB
INHBC
INHBE
InhBP
InhBP-L
InhBP/p120
InhBP-S
Inhibin A
Inhibin-alpha
Inhibin B
Inhibin-beta
Inhibin-beta-A
Inhibin-beta-B
Inhibin-beta-C
Inhibin-beta-D
Inhibin-beta-E
Inhibin binding protein
inhibin-like peptide
inhibin-like peptide-1-31
Inhibins
inhibitor-1 of protein phophatase-2A
inhibitor cystine knot
Inhibitor of apoptosis
Inhibitor of apoptosis-like protein 2
inhibitor of apoptosis protein-1
inhibitor of apoptosis protein-2
inhibitor of apoptosis protein-3
inhibitor of Apoptosis Stimulating p53 Protein
Inhibitor of F1F0-ATPase
inhibitor of caspase-activated DNAse
Inhibitor of differentiation-1
Inhibitor of differentiation-2
Inhibitor of differentiation-3
Inhibitor of DNA binding-1
Inhibitor of DNA binding/differentiation-1
Inhibitor of DNA binding-2
Inhibitor of DNA binding/differentiation-2
Inhibitor of DNA binding-3
Inhibitor of DNA binding/differentiation-3
Inhibitor of DNA binding-4
Inhibitor of DNA binding/differentiation-4
Inhibitor of DNA synthesis
Inhibitor of FLICE
inhibitor of growth 1
inhibitor of growth 1-like
inhibitor of growth 2
inhibitor of growth 2a
inhibitor of growth 2b
inhibitor of growth 3
inhibitor of growth 4
inhibitor of growth 5
Inhibitor of IL2 activity
inhibitor of kappa light polypeptide gene enhancer in B-cells kinase alpha
inhibitor of kappa light polypeptide gene enhancer in B-cells kinase beta
inhibitor of kappa light polypeptide gene enhancer in B-cells kinase gamma
inhibitor of Lutheran
Inhibitor of NF-kappa-B
inhibitor of radiation- and okadaic acid-induced death
Inhibitor of T-cell apoptosis
Inhibitor of TRAF
inhibitor of TRAIL induced death
Inhibitory CARD
Inhibitory diffusible factor-45
Inhibitory factor for cellular DNA
inhibitory member of the ASPP family
Inhibitory receptor protein 60
inhibitory SMAD
INH-IL2
INIKHILAKLVKVLGEVamide
Initiate factor 3
Initiation factor 2-associated 67 kDa glycoprotein
initiation factor M2B-alpha
initiator caspases
INJA
Inka cells
INKKI
iNKT1-cells
iNKT2-cells
iNKT17-cells
iNKT-cells
inlA
inlB
INLKAIAALAKKLL
INLKAIAALARNY
INLKAIAALVKKLL
INLKAIAPLAKKLL
INLKAITALAKKLL
INLKALAALAKALLamide
INLKALAALAKKILamide
INLKALAALKKKLL
In(Lu)
INM02
innate apoptotic immunity
innate apoptotic immunity-associated SUPER determinants
innate B-cells
innate CD8(+) T-cells
innate cells
innate cytokines
innate defense regulator peptide 1
innate defense regulator peptide 1002
innate defense regulator peptide 1018
innate defense regulator peptide 2009
innate defense regulator peptide HH2
innate defense regulator peptides
innate helper cells
innate IL5-producing cells
innate immune cells
innate immunity
Innate immunity and defense peptides Dictionary
Innate immunity Dictionary
innate-like B-cells
innate lymphoid cells
innate lymphoid type 1 cells
innate lymphoid type 2 cells
innate lymphoid type 3 cells
innate memory T-cells
Innate non-T IL5-producing cells
innate regulatory T-cells
Innate response activator B-cells
innate T-cells
innate type 2 helper cells
inner cell mass
inner compact Kenyon cells
inner hair cells
inner noncompact Kenyon cells
inner phalangeal cells
inner pillar cells
inner retinal photoreceptor cells
inner root sheath cells
INNQFLPYPY
INO80 complex subunit F
INO80F
Inosine-5'-monophosphate dehydrogenase 1
Inositol-requiring protein 1
Inositol-requiring protein 1-alpha
Inositol-requiring protein 1-beta
Inositol-requiring protein 2
Inotocin
INP-10
input neurons
INRA
Insect-derived growth factor
insect oxytocin/vasopressin-like peptide
in situ end-labeling
INSL3
INSL3R
INSL3 receptor
INSL4
INSL5
INSL6
INSL7
INSR
insulinase
insulin-B(26-30)
insulin cells
insulin connecting peptide
Insulin C-Peptide
insulin-degrading enzyme
insulin-dependent diabetes mellitus 1
insulin-dependent diabetes mellitus 10
insulin granule-associated carboxypeptidase
Insulin growth factor-like family member 1
Insulin growth factor-like family member 2
Insulin growth factor-like family member 3
Insulin growth factor-like family member 4
Insulin-like-3
Insulin-like 3 A chain
Insulin-like 3 B chain
insulin-like-4
insulin-like-5
Insulin-like 5 A chain
Insulin-like 5 B chain
insulin-like-6
insulin-like-7
insulin-like-7 C peptide
insulin-like androgenic gland hormone
Insulin-like growth factor
Insulin-like growth factor-1
Insulin-like growth factor-1 receptor
Insulin-like growth factor-2
Insulin-like growth factor-3
Insulin-like growth factor binding protein-1
Insulin-like growth factor binding protein-1a
Insulin-like growth factor binding protein-1b
Insulin-like growth factor binding protein-2
Insulin-like growth factor binding protein-2a
Insulin-like growth factor binding protein-2b
Insulin-like growth factor binding protein-3
Insulin-like growth factor binding protein-3 receptor
Insulin-like growth factor binding protein-4
Insulin-like growth factor binding protein-5
Insulin-like growth factor binding protein-5a
Insulin-like growth factor binding protein-5b
Insulin-like growth factor binding protein-6
Insulin-like growth factor binding protein-6a
Insulin-like growth factor binding protein-6b
Insulin-like growth factor binding protein-7
Insulin-like growth factor binding protein-8
Insulin-like growth factor binding protein-9
Insulin-like growth factor binding protein-10
Insulin-like growth factor binding protein 34 kDa
Insulin-like growth factor binding protein 53 kDa
Insulin-like growth factor binding protein related protein-1
Insulin-like growth factor binding protein related protein-2
Insulin-like growth factor binding protein related protein-3
Insulin-like growth factor binding protein related protein-4
Insulin-like growth factor binding protein related protein-10
Insulin-like growth factor binding proteins
Insulin-like growth factor family
Insulin-like peptide 1
Insulin-like peptide 2
Insulin-like peptide 3
Insulin-like peptide 4
Insulin-like peptide 5
Insulin-like peptide 5 A chain
Insulin-like peptide 5 B chain
Insulin-like peptide 6
Insulin-like peptide 6 A chain
Insulin-like peptide 6 B chain
Insulin-like peptide 7
Insulin-like peptide 7 A chain
Insulin-like peptide 7 B chain
Insulin-like peptide 8
insulinoma amyloid polypeptide
Insulinoma-Glucagonoma clone 20
Insulinotropic peptide 1
insulinotropin
insulin-producing cells
insulin protease
insulin proteinase
insulin receptor
Insulin-receptor substrate-1
Insulin-regulated membrane aminopeptidase
Insulin-related factor
insulin-related peptide 1
insulin-related peptide 2
insulin-related peptide 3
insulin-related peptide 4
insulin-related peptide 5
insulin-related peptide 6
insulin-related peptide 7
insulin-related peptide 8
insulin-related peptide-binding protein
Insulin-responsive aminopeptidase
insulysin
int-1
INT1L1
int-1-like 1
int-1-related protein
int-2
int-3
int-4
integral membrane protein 2B
integrin-alpha-1
integrin-alpha-2
integrin-alpha-2b
integrin-alpha-2-beta-M
integrin-alpha-3
integrin-alpha-4
Integrin-alpha-4-beta-1 ligand
integrin-alpha 4-like
integrin-alpha-5
integrin-alpha-6
integrin-alpha-9
integrin-alpha-9/beta-1
integrin-alpha-D
integrin-alpha-E
integrin-alpha-L
integrin-alpha-M
Integrin alpha-RLC
integrin-alpha-V
integrin-alpha-X
integrin-associated protein
integrin-associated signal transducer
integrin association motif
integrin-beta-1
integrin-beta-2
integrin-beta-2-alpha-L
integrin-beta-2-alpha-X
integrin-beta-3
integrin-beta-3 binding protein
integrin-beta-4
integrin-mediated apoptosis
integrin-mediated death
Intelectin
Intelectin-1
Intelectin-2
Intellectual property statement
intensely fluorescent cells
Inter-alpha-inhibitor
Inter-alpha-trypsin inhibitor
Inter-alpha-trypsin inhibitor 92 kDa
Inter-alpha-trypsin inhibitor 98 kDa
Inter-alpha-trypsin inhibitor 107 kDa
Inter-alpha-trypsin inhibitor family heavy chain-related protein
Inter-alpha-trypsin inhibitor H1
Inter-alpha-trypsin inhibitor H2
Inter-alpha-trypsin inhibitor H3
Inter-alpha-trypsin inhibitor H4
Inter-alpha-trypsin inhibitor H5
Inter-alpha-trypsin inhibitor Heavy Chain 1
Inter-alpha-trypsin inhibitor Heavy Chain 2
Inter-alpha-trypsin inhibitor Heavy Chain 3
Inter-alpha-trypsin inhibitor Heavy Chain 4
Inter-alpha-trypsin inhibitor Heavy Chain 5
Inter-alpha-trypsin inhibitor light chain
interbarrelette neurons
intercalary cells
Intercalated amygdala neurons
intercalated amygdalar cells
intercalated cells
intercellular adhesion molecule 1
intercellular adhesion molecule 2
intercellular adhesion molecule 3
intercellular adhesion molecule 4
interceptors
intercrine-alpha family
intercrine-beta family
intercrine reduced in hepatomas
Intercrines
interdental cells
interdigitating cells
interdigitating dendritic cells
interdigitating reticulum cells
Interference hedgehog
interferon-1
interferon-2
interferon-3
interferon-4
Interferon-activable protein 202
Interferon-activable protein 204
interferon activated gene 204
Interferon-alpha
interferon-alpha-1
interferon alpha 1b
interferon-alpha-13
interferon (alpha, beta and omega) receptor 1
interferon (alpha, beta and omega) receptor 2
Interferon alpha-inducible protein 6
Interferon alpha-inducible protein 27
Interferon-beta
interferon-beta-1
Interferon-beta-2
Interferon-beta promoter stimulator protein 1
Interferon consensus sequence binding protein
Interferon consensus sequence binding protein-1
Interferon consensus sequence-binding protein for activated T-cells
Interferon-delta
Interferon-delta-1
Interferon-delta-2
Interferon-delta-8
Interferon-epsilon
interferon-epsilon 1
Interferon-gamma
interferon-gamma-inducible protein-1
interferon-gamma-inducible protein-9
interferon-gamma-inducible protein-16
Interferon-gamma inducing factor
interferon-gamma receptor 1
interferon-gamma receptor 2
interferon-gamma transducer 1
interferon-gamma upregulated protein I-3524
Interferon-induced 17 kDa protein
Interferon-induced 35 kDa protein
Interferon-induced 58 kDa protein
Interferon-induced 60 kDa protein
interferon-induced helicase 1
Interferon-induced helicase C domain-containing protein 1
interferon-induced protein 15
interferon-induced protein 15 kDa
interferon-induced protein 16
interferon-induced protein 16-alpha
interferon-induced protein 16-beta
interferon-induced protein 17
interferon-induced protein 35
Interferon-induced protein 49
interferon-induced protein 53 kDa
interferon-induced protein 54
interferon-induced protein 56
Interferon-induced protein 53
interferon-induced protein 60
Interferon-induced protein 6-16
interferon-induced protein with tetratricopeptide repeats-1
interferon-induced protein with tetratricopeptide repeats-2
interferon-induced protein with tetratricopeptide repeats-3
interferon-induced protein with tetratricopeptide repeats-4
interferon-induced protein with tetratricopeptide repeats-5
interferon-induced transmembrane protein 1
interferon-induced transmembrane protein 2
interferon-induced transmembrane protein 3
interferon-inducible mRNA 561
Interferon-inducible-10
Interferon-inducible 78 kDa protein
Interferon-inducible protein-10
Interferon-inducible protein 15
Interferon-inducible protein 1-8D
Interferon-inducible protein 1-8U
Interferon-inducible protein 210
Interferon-inducible protein 9-27
Interferon-inducible protein p204
Interferon-inducible protein X
interferon-inducible secretoglobin
Interferon-inducible T-cell alpha chemoattractant
Interferon-kappa
interferon-lambda-1
interferon-lambda-2
interferon-lambda-3
interferon-lambda-4
interferon-lambda receptor
interferon-lambda receptor-1
Interferon-omega
interferon-omega-1
interferon-producing killer dendritic cells
interferon regulating factor-2 binding protein 2A
Interferon regulatory factor
Interferon regulatory factor-1
Interferon regulatory factor-2
interferon regulatory factor-2 binding protein 1
Interferon regulatory factor-3
Interferon regulatory factor-4
interferon regulatory factor-5
Interferon regulatory factor-6
Interferon regulatory factor-7
interferon regulatory factor-7A
interferon regulatory factor-7B
interferon regulatory factor-7C
interferon regulatory factor-7H
interferon regulatory factor-8
Interferon regulatory factor-10
interferon-related developmental regulator-1
interferon-related developmental regulator-2
Interferon-related protein
Interferon response sequence
interferon response transcript 1
Interferons
Interferon-stimulated 20 kDa exonuclease-like 1
Interferon-stimulated gene 12
Interferon-stimulated gene 12a
Interferon-stimulated gene-15
Interferon-stimulated gene factor-1
Interferon-stimulated gene factor-2
Interferon-stimulated gene factor-3
interferon-stimulated protein 54
interferon-stimulated protein 56
Interferon-stimulated response element
Interferon-tau
interferon-tau-1
interferon-tau-4
interferon type 1 cluster
Interferon-zeta
interfollicular cells
intergenic RNAs
Interlaminar astrocytes
Interleukin-1
Interleukin-1-alpha
Interleukin-1-beta
interleukin-1-beta-1
interleukin-1-beta-2
Interleukin-1-beta converting enzyme
Interleukin-1-delta
Interleukin-1-epsilon
interleukin-1-eta
interleukin-1 family
Interleukin-1 family member 1
Interleukin-1 family member 2
Interleukin-1 family member 3
Interleukin-1 family member 4
Interleukin-1 family member 5
Interleukin-1 family member 6
Interleukin-1 family member 7
Interleukin-1 family member 7a
Interleukin-1 family member 7b
Interleukin-1 family member 7c
Interleukin-1 family member 7d
Interleukin-1 family member 7e
Interleukin-1 family member 8
Interleukin-1 family member 9
Interleukin-1 family member 10
Interleukin-1 family member 11
interleukin-1-gamma
Interleukin-1 Inhibitor
Interleukin-1 receptor 1
Interleukin-1 receptor 2
Interleukin-1 receptor 3
Interleukin-1 receptor 4
Interleukin-1 receptor 5
Interleukin-1 receptor 6
Interleukin-1 receptor 7
Interleukin-1 receptor 8
Interleukin-1 receptor 9
Interleukin-1 receptor-alpha
Interleukin-1 receptor antagonist
Interleukin-1 receptor-beta
Interleukin-1 receptor family
interleukin-1 receptor-like 1
interleukin-1 receptor-like-1 ligand
interleukin-1 receptor-like 2
Interleukin-1ss
interleukin-1-theta
interleukin-1-zeta
Interleukin-2
interleukin-2 receptor
interleukin-2 receptor-alpha
interleukin-2 receptor-beta
interleukin-2 receptor-gamma
Interleukin-3
interleukin-3 receptor-alpha
interleukin-3 receptor-beta
Interleukin-4
interleukin-4-producing B-cells
interleukin-4 receptor
interleukin-4 receptor-alpha
Interleukin-5
interleukin-5 receptor
interleukin-5 receptor-alpha
interleukin-5 receptor-beta
Interleukin-6
interleukin-6 family
interleukin-6 receptor
interleukin-6 receptor-alpha
interleukin-6 receptor-beta
interleukin-6 signal transducer
Interleukin-7
interleukin-7 receptor
interleukin-7 receptor-alpha
Interleukin-8
interleukin-8nL
interleukin-8 protease
interleukin-8 receptor-alpha
interleukin-8 receptor-beta
interleukin-8 receptor type 1
interleukin-8 receptor type 2
interleukin-8 receptor type A
interleukin-8 receptor type B
interleukin-8X
Interleukin-9
interleukin-9-producing T-cells
interleukin-9 receptor
Interleukin-10
interleukin-10a
interleukin-10b
Interleukin-10C
Interleukin-10D
interleukin-10 family
interleukin-10-induced regulatory T-cells
interleukin-10-producing B-cells
interleukin-10-producing dendritic cells
interleukin-10-producing innate lymphoid cells
interleukin-10-producing T-cells
interleukin-10 receptor
interleukin-10 receptor-alpha
interleukin-10 receptor-beta
Interleukin-11
Interleukin-11a
Interleukin-11b
interleukin-11 receptor-alpha
interleukin-11 receptor-alpha-1
interleukin-11 receptor-alpha-2
interleukin-11 receptor alpha-locus chemokine
interleukin-11 receptor-beta
Interleukin-12
Interleukin-12A
Interleukin-12-alpha
Interleukin-12B
Interleukin-12-beta
interleukin-12 family
interleukin-12 receptor
interleukin-12 receptor-beta
interleukin-12 receptor-beta-1
interleukin-12 receptor-beta-2
Interleukin-13
Interleukin-13 binding protein
interleukin-13 peptide
interleukin-13/interleukin-22-coproducing cells
interleukin-13 receptor-alpha-1
interleukin-13 receptor-alpha-2
Interleukin-14
Interleukin-14-alpha
Interleukin-14-beta
Interleukin-15
Interleukin-16
Interleukin-17
Interleukin-17A
Interleukin-17A/F
interleukin-17-alpha
interleukin-17A-producing neutrophil-regulatory Tn lymphocytes
Interleukin-17B
Interleukin-17B receptor
Interleukin-17C
Interleukin-17D
Interleukin-17E
Interleukin-17F
interleukin-17 family
interleukin-17-producing innate lymphoid cells
interleukin-17-producing NKT-cells
interleukin-17-producing T-cells
interleukin-17-producing Th2 cells
interleukin-17 receptor A
interleukin-17 receptor B
interleukin-17 receptor C
interleukin-17 receptor C(376-387)
interleukin-17 receptor D
interleukin-17 receptor E
interleukin-17 receptor E-like
Interleukin-17 receptor homolog
interleukin-17 receptor-like protein
interleukin-17-secreting T-cells
interleukin-17(+) T-helper cells
Interleukin-18
interleukin-18 binding protein
interleukin-18 receptor-1
interleukin-18 receptor-alpha
interleukin-18 receptor-beta
Interleukin-19
Interleukin-20
interleukin-20 family
interleukin-20L
interleukin-20-like
interleukin-20 receptor-alpha
interleukin-20 receptor-beta
Interleukin-21
interleukin-21 receptor
interleukin-21 receptor-alpha
Interleukin-22
interleukin-22-producing innate lymphoid cells
interleukin-22-producing T-cells
interleukin-22 receptor-1
interleukin-22 receptor-alpha-1
interleukin-22 receptor-alpha-2
Interleukin-23
Interleukin-23A
interleukin-23-alpha
Interleukin-23 p19
Interleukin-23 p40
interleukin-23 receptor
Interleukin-24
Interleukin-25
interleukin-25 receptor
Interleukin-26
Interleukin-27
interleukin-27-alpha
interleukin-27-beta
interleukin-27 receptor-alpha
Interleukin-28
Interleukin-28A
interleukin-28-alpha
Interleukin-28B
interleukin-28-beta
interleukin-28C
interleukin-28 receptor-1
interleukin-28 receptor-alpha
Interleukin-29
Interleukin-30
Interleukin-31
interleukin-31 receptor A
interleukin-31 receptor-alpha
Interleukin-31 receptor-beta
Interleukin-32
Interleukin-32-alpha
Interleukin-32-beta
Interleukin-32-delta
Interleukin-32-epsilon
interleukin-32-eta
Interleukin-32-gamma
interleukin-32s
Interleukin-32-zeta
interleukin-32-theta
Interleukin-33
interleukin-34
interleukin-35
Interleukin-35-producing B-cells
interleukin-35-producing induced regulatory T-cells
Interleukin-35-producing regulatory B-cells
interleukin-36
interleukin-36-alpha
interleukin-36-beta
interleukin-36-gamma
interleukin-36 receptor
interleukin-36 receptor antagonist
interleukin-37
interleukin-37a
interleukin-37b
interleukin-37c
interleukin-37d
interleukin-37e
interleukin-38
interleukin-39
interleukin-40
interleukin-41
Interleukin-2[22-58]
Interleukin-8(72-94)
interleukin-8(80-99)
interleukin-8(81-99)
interleukin-33(1-270)
interleukin-33(95-270)
interleukin-33(99-270)
interleukin-33(109-270)
Interleukin-beta
Interleukin B
Interleukin enhancer binding factor
Interleukin for Da cells
Interleukin-hemopoietin-1
Interleukin-HP1
Interleukin-hybridoma/plasmacytoma-1
Interleukin-like EMT inducer
Interleukins
Interleukin T
Interleukin-X
Interleukin-Y
intermediate epiblast stem cells
intermediate germ cells
intermediate lactotrophs
intermediate monocytes
intermediate progenitor cells
intermediate radial glia cells
intermediate tufted cells
intermediate type neuroblastoma cells
Intermedin
Intermedin(1-47)
Intermedin(1-53)
Intermedin(8-47)
internalin A
internalin B
internalins
internalization peptides
internalizing-RGD
Internal Transfer-RNA-derived small RNAs
Internal tRFs
internal tufted cells
Interneuromast cells
interneurons
internuncial neurons
interphase cell death
interplexiform cells
Intersectin-1
interspecies specificity
interstitial Cajal-like cells
interstitial cells
interstitial cells of Cajal
interstitial cells of Leydig
interstitial cells of the heart valves
interstitial cells of the white matter
interstitial cell-stimulating hormone
interstitial collagenase
Interstitial collagenase A
Interstitial collagenase B
interstitial dendritic cells
interstitial neurons
interstitial white matter neurons
intervertebral disc cells
intestinal absorptive cells
intestinal anti-proliferative factor
intestinal calcium-binding protein
intestinal dipeptidyl peptidase
intestinal M cells
Intestinal organoids
Intestinal peptide PHM-27
Intestinal peptide PHV-42
intestinal subepithelial myofibroblasts
intestinal trefoil factor
Intestinal trefoil factor-1
Intestinal trefoil factor-2
Intestinal trefoil factor-3
intestine tyrosine kinase
intimal collagen
Intimin
intrabodies
Intracellular chemokine
intracellular domains
intracellular FGFs
intracellular hyaluronic acid binding protein
Intracellular IL1ra
intracellular renin
Intracrine
Intracisternal A particles
intraepithelial cytotoxic T-lymphocytes
intraepithelial lymphocytes
intraepithelial T-cells
intraepithelial type 1 ILCs
intraepithelial type 1 innate lymphoid cells
intraflagellar transport protein
Intraflagellar transport protein 57 homolog
intraflagellar transport protein 121
Intrafusal muscle fibers
Intragenic antimicrobial peptides
intrahepatic biliary epithelial cells
intrakine
intraluminal splitting angiogenesis
Intramuscular enteric gliocytes
Intrathymic lipid-laden multilocular cells
intraventricular macrophages
intrinsically bursting neurons
intrinsically disordered proteins
intrinsically photosensitive retinal ganglion cells
Intrinsically unstructured proteins
intrinsic apoptosis
intrinsic neurons
Intron-A
intronic RNAs
introns
intussusceptive angiogenesis
Intussusceptive microvascular growth
inv
invaginating midget bipolar cells
invariant natural killer T-cells
invariant NKT1-cells
invariant NKT2-cells
invariant NKT17-cells
invariant NKT-cells
invasin(ent)
invasin(pstb)
Invasins
Invasion-inhibiting factor-2
invasion plasmid antigen A
invasion plasmid antigen B
invasion plasmid antigen C
invasion plasmid antigen D
Invasion stimulating factor
invasive trophoblast antigen
inv(ent)
inversely correlated with estrogen receptor expression 1
invertebrate lysozyme 3
invertebrate tachykinins
in vitro generated regulatory T-cells
in vitro generated Tregs
in vitro induced regulatory T-cells
in vitro induced Tregs
in vitro wound assay
In Vivo Cytokine Capture Assay
in vivo-induced gene VI-A
INVLGILGLLGKALSELamide
invNKT-cells
inv(pstb)
inv-TKs
INWKKIAEIGKQVLSAL
INWKKIAEVGGKILSSL
INWKKWWQVFYTVVamide
INWLKLGKAIIDAL

ionized calcium binding adaptor molecule-1
ionizing radiation resistance conferring protein
ionoblasts
ionocytes

IP-9
IP-10
IP-10 receptor
IP15
IP17
IpaA
IpaB
IpaC
IpaD
IPAF
IPAF inflammasome
IPA-S4/5 cells
IPAVFK
IPC
IPCs
IPFS
IPGVG
IPGYSHSFVamide
Ipilimumab
IPL
IPLRGAFINGRWDSQCCHRFSNGAIACA
IPMYDFGIamide
IPN/45
IPNamide
IPNV VP5
IPO-3
IPO-24
IPP
ipRGCs
IPRPLDPCIAQNGRCFTGICRYPYFWIGTCRNGKSCCRRR
IPS1
iPS cells
iPSCs
iPSC/TF-based transdifferentiation
iPSC transcription factor-based transdifferentiation
IPSF
IPSF-2-alpha
IPSF-2-beta
IPYIL

IQKTPQIQVY
IQW

ir
IR1
IRA-B-cells
IRAK
IRAK1
IRAK1b
IRAK1 binding protein 1
IRAK1BP1
IRAK1c
IRAK1S
IRAK1W
IRAK2
IRAK3
IRAK4
IRAKM
IRAP
IRAP aminopeptidase
IRAS
IRAS-L
IRAS-M
IRAS-S
IRC1
IRC2
ird5
ird7
ird15
IRE1
IRE1A
IRE1-alpha
IRE1B
IRE1-beta
IRE2
IREB1
IRE-binding protein
IRE-binding protein 1
IREBP
IREBP1
IREG1
I-Rel
IREM1
IREM2
IREM3
Iressa
ir-FGF
IRF
IRF1
IRF2
IRF2 binding protein 1
IRF2 binding protein 2A
IRF2 binding protein-like
IRF2BP1
IRF2BP2A
IRF2BPL
IRF3
IRF4
IRF5
IRF6
IRF7
IRF7A
IRF7B
IRF7C
IRF8
IRF10
IRFD2
IRFH
irg-1
irg-2
IRG2
IRGCs
iRGD
IRH
Iric-1
iridocytes
iridophore
Iridovirus CARD protein
Iridovirus caspase activation and recruitment domain protein
Iris-expressed growth factor
Irisin
IRL11
IRMA
iRNAs
irNCs
IROD
iron-dependent cell death
iron (II) - oxygen oxidoreductase
iron-laden macrophages
iron-regulated transporter-1
iron regulatory factor
iron regulatory protein 1
iron-responsive element binding protein 1
IRP
IRP1
IRp60
IRQ peptide
IRQRRRR
irradiated preformed stroma
IRS
IRS-1
IRT-1
IRTA1
IRTA1A
IRTA1B
IRTA1C
IRTA2
IRTA3
IRTA4
IRTA5
IRW

ISAAEFGKINGPIKK
ISAMP
ISCDKF
ischemia-reperfusion injury
iSCs
IsCT
IsCT2
IsCT2f
IsCTf
IsCT-P
ISDRDYMGWMDF
ISDYSIRMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
iseganan
ISEL
IsElev
ISEMFs
ISF
ISG
ISG12
ISG12a
ISG15
ISG15 conjugates
ISG20L1
ISG49
ISG54
ISG56
ISG58
ISG60
ISGF-1
ISGF-2
ISGF-3
ISGylation
ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDL
ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKamide
ISKNV orf48R
islet amyloid polypeptide
islet-brain-1
islet-brain-2
islet cells
Islet cells regeneration factor
islet hormones
islet neogenesis associated protein
Islet-Neogenesis Associated Protein-Pentadecapeptide
Islet of Langerhans regenerating protein
Islet of Langerhans regenerating protein 1
Islet of Langerhans regenerating protein 2
Islet of Langerhans regenerating protein 3
isletokines
islet stellate cells
ISLMKRPPGFSPFR
ISLR
ISM
ISM1
I-SMAD
isoaspartate-glycine-arginine
isocitrate dehydrogenase 3 gamma-like
isoDGR
isoferritin
isolation membrane
isoleucine tRNA ligase 1
isoleucyl-tRNA synthetase
isomeric microRNAs
isomiRs
Isotocin
Isotype switching
ISPs
ISPS
Isracidin
ISRE
ISRPPGFSPFR
Isthmin
isthmin-1
isthmo-optic target cells

IT
ITA
I-TAC
ITAM
ITC cells
ITC neurons
ITCcs
ITF
ITGA1
ITGA2
ITGA2B
ITGA3
ITGA4
ITGA4L
ITGA5
ITGA6
ITGA9
ITGAB
ITGAD
ITGAE
ITGAL
ITGAM
ITGAV
ITGAX
ITGB1
ITGB2
ITGB3
ITGB3BP
ITGB4
ITI
ITID
ITIH1
ITIH2
ITIH3
ITIH4
ITIH5
ITI-HC1
ITI-HC2
ITI-HC3
ITI-HC4
ITI-HC5
ITIHL1
ITI-LC
ITIM
ITK
ITLN
ITLN1
ITLN2
ITM2B
ITM2Bs
ITNK-cells
Ito cells
I-TRAF
iTr35
iTregs
itRFs
iTS cells
ITSMs
ITSN-1
I-type lectins
I-type neuroblastoma cells

IVCCA
IVD cells
iviVI-A
IVKNLQNLDPSHRISDRDYMGWMDF
IVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
IVRLLSKKVKNM
IVRRADRAAVP
IVSDGNGMNAWVAWR
IVSYPDDAGEHAHKMGamide
Ivy cells

IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ
IWLTALKFLGKHAAKHLAKQQLSKLamide
IWLTALKFLGKNLGKHLAKQQLAKL
IWMN

Ixodes 15-kDa salivary gland protein
Ixodes ricinus periviscerokinin
Ixodes scapularis Antimicrobial Peptide
Ixodes scapularis elevenin
Ixodes scapularis Sialostatin L
Ixodes scapularis Sialostatin L2
Ixodidin
Ixori-PVK
Ixosin
ixosin-B

iyk



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.