IL15 receptor-beta |
IL17 |
QKNDTAFSCHFFEIYLSNCFNKEKYIKNYLQIM |
||
[Interleukin-16] This factor has been described originally as Lymphocyte chemoattractant factor (LCF), which is produced by CD4(+) and CD8(+) T-cells and acts as a chemoattractant for lymphocytes. The IL16 protein is derived from a much larger biologically inactive precursor (Baier et al, 1997; Bannert et al, 1996). Cleavage of bioactive secreted IL16 from its precursor is mediated by Caspase-3 (Wu et al, 1999). Bannert et al (1999) have cloned the murine gene. Keane et al (1998) have reported a high degree of structural and functional similarity between human and murine
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |