ILGTILGLLKSL |
ILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Protein Fv |
||
[interleukin-hemopoietin-1] (H = Hybridoma; P = plasmacytoma; see also: HP1). A murine T-cell derived factor with growth factor activity for B-cell hybridomas and plasmacytomas (see also: PCT-GF, plasmacytoma growth factor). This factor was later shown to be produced also by macrophages and fibroblasts.
Van Snick et al (1988) have proposed the name IL6 for this factor.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |