IL1RAP |
IL1RAPL1 |
KDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN |
||
[IL1 receptor accessory protein-like] abbr. also: IL1RAcPL. The receptor is a member of the IL1 receptor family.
Also known as IL1RAPL1 [IL1 receptor accessory protein-like-1], TIGIRR-2 (three immunoglobulin domain-containing IL1 receptor-related-2), or IL1R8 [Interleukin-1 receptor 8, IL1 receptor R8]. The gene encodes a protein of 696 amino acids with homology to IL1RAcP [IL1 receptor accessory protein]. IL1RAPL1 shares 65 % identity with IL1RAPL2 (Jin et al, 2000).
Born et al (2000) have suggested that IL1RAPL1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |